Recombinant Human ECM1 protein(20-241 aa), His-tagged
Cat.No. : | ECM1-3579H |
Product Overview : | Recombinant Human ECM1 protein(20-241 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | July 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-241 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGMPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAM |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | ECM1 extracellular matrix protein 1 [ Homo sapiens ] |
Official Symbol | ECM1 |
Synonyms | ECM1; extracellular matrix protein 1; secretory component p85 |
Gene ID | 1893 |
mRNA Refseq | NM_001202858 |
Protein Refseq | NP_001189787 |
MIM | 602201 |
UniProt ID | Q16610 |
◆ Recombinant Proteins | ||
ECM1-691H | Recombinant Human ECM1, His tagged | +Inquiry |
ECM1-1401H | Recombinant Human ECM1 Protein, His-tagged | +Inquiry |
ECM1-12269H | Recombinant Human ECM1, GST-tagged | +Inquiry |
ECM1-925H | Recombinant Human ECM1 Protein, MYC/DDK-tagged | +Inquiry |
Ecm1-1122R | Recombinant Rat Ecm1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ECM1-2036MCL | Recombinant Mouse ECM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECM1 Products
Required fields are marked with *
My Review for All ECM1 Products
Required fields are marked with *