Recombinant Human ECM1 protein(20-241 aa), His-tagged
| Cat.No. : | ECM1-3579H |
| Product Overview : | Recombinant Human ECM1 protein(20-241 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 20-241 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | ASEGGFTATGQRQLRPEHFQEVGYAAPPSPPLSRSLPMDHPDSSQHGPPFEGQSQVQPPPSQEATPLQQEKLLPAQLPAEKEVGPPLPQEAVPLQKELPSLQHPNEQKEGMPAPFGDQSHPEPESWNAAQHCQQDRSQGGWGHRLDGFPPGRPSPDNLNQICLPNRQHVVYGPWNLPQSSYSHLTRQGETLNFLEIGYSRCCHCRSHTNRLECAKLVWEEAM |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | ECM1 extracellular matrix protein 1 [ Homo sapiens ] |
| Official Symbol | ECM1 |
| Synonyms | ECM1; extracellular matrix protein 1; secretory component p85 |
| Gene ID | 1893 |
| mRNA Refseq | NM_001202858 |
| Protein Refseq | NP_001189787 |
| MIM | 602201 |
| UniProt ID | Q16610 |
| ◆ Recombinant Proteins | ||
| ECM1-4172HF | Recombinant Full Length Human ECM1 Protein, GST-tagged | +Inquiry |
| ECM1-2006R | Recombinant Rat ECM1 Protein | +Inquiry |
| ECM1-1401H | Recombinant Human ECM1 Protein, His-tagged | +Inquiry |
| ECM1-315H | Active Recombinant Human ECM1, His-tagged | +Inquiry |
| ECM1-691H | Recombinant Human ECM1, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ECM1-2036MCL | Recombinant Mouse ECM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ECM1 Products
Required fields are marked with *
My Review for All ECM1 Products
Required fields are marked with *
