Recombinant Human EDARADD Protein, GST-tagged

Cat.No. : EDARADD-61H
Product Overview : Human EDARADD full-length ORF (BAF83551.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. The protein encoded by this gene is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 51.2 kDa
AA Sequence : MGLRTTKQIGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name EDARADD EDAR associated death domain [ Homo sapiens (human) ]
Official Symbol EDARADD
Synonyms ED3; EDA3; ECTD11A; ECTD11B
Gene ID 128178
mRNA Refseq NM_145861.2
Protein Refseq NP_665860.2
MIM 606603
UniProt ID Q8WWZ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EDARADD Products

Required fields are marked with *

My Review for All EDARADD Products

Required fields are marked with *

0
cart-icon
0
compare icon