Recombinant Human EDARADD Protein, GST-tagged
Cat.No. : | EDARADD-61H |
Product Overview : | Human EDARADD full-length ORF (BAF83551.1, 1 a.a. - 215 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene was identified by its association with ectodermal dysplasia, a genetic disorder characterized by defective development of hair, teeth, and eccrine sweat glands. The protein encoded by this gene is a death domain-containing protein, and is found to interact with EDAR, a death domain receptor known to be required for the development of hair, teeth and other ectodermal derivatives. This protein and EDAR are coexpressed in epithelial cells during the formation of hair follicles and teeth. Through its interaction with EDAR, this protein acts as an adaptor, and links the receptor to downstream signaling pathways. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 51.2 kDa |
AA Sequence : | MGLRTTKQIGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | EDARADD EDAR associated death domain [ Homo sapiens (human) ] |
Official Symbol | EDARADD |
Synonyms | ED3; EDA3; ECTD11A; ECTD11B |
Gene ID | 128178 |
mRNA Refseq | NM_145861.2 |
Protein Refseq | NP_665860.2 |
MIM | 606603 |
UniProt ID | Q8WWZ3 |
◆ Recombinant Proteins | ||
Edaradd-2724M | Recombinant Mouse Edaradd Protein, Myc/DDK-tagged | +Inquiry |
EDARADD-1895C | Recombinant Chicken EDARADD | +Inquiry |
EDARADD-61H | Recombinant Human EDARADD Protein, GST-tagged | +Inquiry |
EDARADD-477C | Recombinant Cynomolgus EDARADD Protein, His-tagged | +Inquiry |
EDARADD-976HF | Recombinant Full Length Human EDARADD Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDARADD-6727HCL | Recombinant Human EDARADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDARADD Products
Required fields are marked with *
My Review for All EDARADD Products
Required fields are marked with *