Recombinant Human EDIL3 protein, GST-tagged
| Cat.No. : | EDIL3-12281H |
| Product Overview : | Recombinant Human EDIL3 protein(131-480 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | November 24, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 131-480 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | GGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | EDIL3 EGF-like repeats and discoidin I-like domains 3 [ Homo sapiens ] |
| Official Symbol | EDIL3 |
| Synonyms | EDIL3; EGF-like repeats and discoidin I-like domains 3; EGF-like repeat and discoidin I-like domain-containing protein 3; DEL1; integrin-binding protein DEL1; developmental endothelial locus-1; developmentally-regulated endothelial cell locus 1 protein; MGC26287; |
| Gene ID | 10085 |
| mRNA Refseq | NM_005711 |
| Protein Refseq | NP_005702 |
| MIM | 606018 |
| UniProt ID | O43854 |
| ◆ Recombinant Proteins | ||
| EDIL3-3827H | Recombinant Human EDIL3 protein(24-480aa), His-tagged | +Inquiry |
| EDIL3-974H | Active Recombinant Human EDIL3 Protein, His-tagged | +Inquiry |
| Edil3-2728M | Recombinant Mouse Edil3 Protein, Myc/DDK-tagged | +Inquiry |
| EDIL3-001H | Recombinant Human EDIL3 Protein, His-tagged | +Inquiry |
| EDIL3-4990M | Recombinant Mouse EDIL3 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EDIL3-6722HCL | Recombinant Human EDIL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDIL3 Products
Required fields are marked with *
My Review for All EDIL3 Products
Required fields are marked with *
