Recombinant Human EDIL3 protein(321-470 aa), N-SUMO & C-His-tagged

• Cat.No.: EDIL3-2471H
• Product Overview: Recombinant Human EDIL3 protein(O43854)(321-470 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 321-470 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLR

Gene Information

• Gene Name: EDIL3 EGF-like repeats and discoidin I-like domains 3 [ Homo sapiens ]
• Official Symbol: EDIL3
• Synonyms: EDIL3; EGF-like repeats and discoidin I-like domains 3; EGF-like repeat and discoidin I-like domain-containing protein 3; DEL1; integrin-binding protein DEL1; developmental endothelial locus-1; developmentally-regulated endothelial cell locus 1 protein; MGC26287
• Gene ID: 10085
• mRNA Refseq: NM_005711
• Protein Refseq: NP_005702
• MIM: 606018
• UniProt ID: O43854