Recombinant Human EDIL3 protein(321-470 aa), N-SUMO & C-His-tagged
Cat.No. : | EDIL3-2471H |
Product Overview : | Recombinant Human EDIL3 protein(O43854)(321-470 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 321-470 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLR |
Gene Name | EDIL3 EGF-like repeats and discoidin I-like domains 3 [ Homo sapiens ] |
Official Symbol | EDIL3 |
Synonyms | EDIL3; EGF-like repeats and discoidin I-like domains 3; EGF-like repeat and discoidin I-like domain-containing protein 3; DEL1; integrin-binding protein DEL1; developmental endothelial locus-1; developmentally-regulated endothelial cell locus 1 protein; MGC26287; |
Gene ID | 10085 |
mRNA Refseq | NM_005711 |
Protein Refseq | NP_005702 |
MIM | 606018 |
UniProt ID | O43854 |
◆ Recombinant Proteins | ||
EDIL3-1943H | Active Recombinant Human EDIL3 protein, Fc-tagged | +Inquiry |
EDIL3-3827H | Recombinant Human EDIL3 protein(24-480aa), His-tagged | +Inquiry |
EDIL3-001H | Recombinant Human EDIL3 Protein, His-tagged | +Inquiry |
EDIL3-974H | Active Recombinant Human EDIL3 Protein, His-tagged | +Inquiry |
EDIL3-2639M | Recombinant Mouse EDIL3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDIL3-6722HCL | Recombinant Human EDIL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDIL3 Products
Required fields are marked with *
My Review for All EDIL3 Products
Required fields are marked with *