Recombinant Human EDNRA Full Length Transmembrane protein, His-tagged
Cat.No. : | EDNRA-2371H |
Product Overview : | Recombinant Human EDNRA protein(P25101)(21–427aa), fused to C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21–427aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.9kDa |
AA Sequence : | DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | EDNRA endothelin receptor type A [ Homo sapiens ] |
Official Symbol | EDNRA |
Synonyms | EDNRA; endothelin receptor type A; endothelin-1 receptor; G protein-coupled receptor; endothelin receptor subtype A; endothelin-1-specific receptor; ETA; ET-A; ETAR; ETRA; ETA-R; hET-AR; |
Gene ID | 1909 |
mRNA Refseq | NM_001166055 |
Protein Refseq | NP_001159527 |
MIM | 131243 |
UniProt ID | P25101 |
◆ Recombinant Proteins | ||
EDNRA-2641M | Recombinant Mouse EDNRA Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL7142OF | Recombinant Full Length Sheep Endothelin-1 Receptor(Ednra) Protein, His-Tagged | +Inquiry |
EDNRA-6775HF | Recombinant Full Length Human EDNRA Protein | +Inquiry |
EDNRA-5744H | Recombinant Human EDNRA protein, His-tagged | +Inquiry |
EDNRA-22H | Recombinant Human EDNRA Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDNRA-6718HCL | Recombinant Human EDNRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDNRA Products
Required fields are marked with *
My Review for All EDNRA Products
Required fields are marked with *
0
Inquiry Basket