Recombinant Human EDNRA Protein
| Cat.No. : | EDNRA-22H |
| Product Overview : | Human EDNRA full-length ORF (ENSP00000315011) recombinant protein without tag was expressed in wheat germ. Liposomes. |
| Availability | January 31, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Description : | This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
| Form : | Liquid |
| Molecular Mass : | 48.7 kDa |
| AA Sequence : | METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN |
| Applications : | Antibody Production Functional Study Compound Screening |
| Usage : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | EDNRA |
| Official Symbol | EDNRA endothelin receptor type A [ Homo sapiens (human) ] |
| Synonyms | EDNRA; endothelin receptor type A; ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR endothelin-1 receptor; G protein-coupled receptor; endothelin receptor subtype A; endothelin-1-specific receptor |
| Gene ID | 1909 |
| mRNA Refseq | NM_001957 |
| Protein Refseq | NP_001948 |
| MIM | 131243 |
| UniProt ID | P25101 |
| ◆ Recombinant Proteins | ||
| EDNRA-5695C | Recombinant Chicken EDNRA | +Inquiry |
| EDNRA-6775HF | Recombinant Full Length Human EDNRA Protein | +Inquiry |
| RFL7029CF | Recombinant Full Length Dog Endothelin-1 Receptor(Ednra) Protein, His-Tagged | +Inquiry |
| RFL7142OF | Recombinant Full Length Sheep Endothelin-1 Receptor(Ednra) Protein, His-Tagged | +Inquiry |
| RFL24996RF | Recombinant Full Length Rat Endothelin-1 Receptor(Ednra) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EDNRA-6718HCL | Recombinant Human EDNRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDNRA Products
Required fields are marked with *
My Review for All EDNRA Products
Required fields are marked with *
