Recombinant Human EDNRA Protein

Cat.No. : EDNRA-22H
Product Overview : Human EDNRA full-length ORF (ENSP00000315011) recombinant protein without tag was expressed in wheat germ. Liposomes.
Availability July 09, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]
Form : Liquid
Molecular Mass : 48.7 kDa
AA Sequence : METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name EDNRA
Official Symbol EDNRA endothelin receptor type A [ Homo sapiens (human) ]
Synonyms EDNRA; endothelin receptor type A; ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR endothelin-1 receptor; G protein-coupled receptor; endothelin receptor subtype A; endothelin-1-specific receptor
Gene ID 1909
mRNA Refseq NM_001957
Protein Refseq NP_001948
MIM 131243
UniProt ID P25101

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EDNRA Products

Required fields are marked with *

My Review for All EDNRA Products

Required fields are marked with *

0
cart-icon