Recombinant Human EDNRA protein, His-tagged
Cat.No. : | EDNRA-5744H |
Product Overview : | Recombinant Human EDNRA protein(21-78 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-78 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSA |
Gene Name | EDNRA endothelin receptor type A [ Homo sapiens ] |
Official Symbol | EDNRA |
Synonyms | EDNRA; endothelin receptor type A; endothelin-1 receptor; G protein-coupled receptor; endothelin receptor subtype A; endothelin-1-specific receptor; ETA; ET-A; ETAR; ETRA; ETA-R; hET-AR; |
Gene ID | 1909 |
mRNA Refseq | NM_001166055 |
Protein Refseq | NP_001159527 |
MIM | 131243 |
UniProt ID | P25101 |
◆ Recombinant Proteins | ||
RFL27599MF | Recombinant Full Length Mouse Endothelin-1 Receptor(Ednra) Protein, His-Tagged | +Inquiry |
EDNRA-1405H | Recombinant Human EDNRA Protein, His-tagged | +Inquiry |
EDNRA-28562TH | Recombinant Human EDNRA | +Inquiry |
EDNRA-2371H | Recombinant Human EDNRA Full Length Transmembrane protein, His-tagged | +Inquiry |
EDNRA-764H | Active Recombinant Human EDNRA Full Length Transmembrane protein(VLPs) | +Inquiry |
◆ Cell & Tissue Lysates | ||
EDNRA-6718HCL | Recombinant Human EDNRA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDNRA Products
Required fields are marked with *
My Review for All EDNRA Products
Required fields are marked with *