Recombinant Human EDNRB protein, GST-tagged
| Cat.No. : | EDNRB-1287H |
| Product Overview : | Recombinant Human EDNRB protein(27-99 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 27-99 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | EERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNASLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKET |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | EDNRB endothelin receptor type B [ Homo sapiens ] |
| Official Symbol | EDNRB |
| Synonyms | EDNRB; endothelin receptor type B; HSCR, HSCR2; endothelin B receptor; ETB; endothelin receptor non-selective type; ET-B; ETBR; ETRB; HSCR; WS4A; ABCDS; ET-BR; HSCR2; |
| Gene ID | 1910 |
| mRNA Refseq | NM_000115 |
| Protein Refseq | NP_000106 |
| MIM | 131244 |
| UniProt ID | P24530 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EDNRB Products
Required fields are marked with *
My Review for All EDNRB Products
Required fields are marked with *
