Recombinant Human EEA1

Cat.No. : EEA1-28464TH
Product Overview : Recombinant fragment of Human EEA1 with a proprietary tag: predicted molecular weight 36.63 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : EEA1 is Early Endosome Antigen 1 protein that binds phospholipid vesicles containing phosphatidylinositol 3-phosphate, which is necessary for endosomal trafficking.
Molecular Weight : 36.630kDa inclusive of tags
Biological activity : This product is useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
Sequence Similarities : Contains 1 C2H2-type zinc finger.Contains 1 FYVE-type zinc finger.
Gene Name EEA1 early endosome antigen 1 [ Homo sapiens ]
Official Symbol EEA1
Synonyms EEA1; early endosome antigen 1; early endosome antigen 1, 162kD; ZFYVE2;
Gene ID 8411
mRNA Refseq NM_003566
Protein Refseq NP_003557
MIM 605070
Uniprot ID Q15075
Chromosome Location 12q22
Pathway Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Phagosome, organism-specific biosystem;
Function 1-phosphatidylinositol binding; GTP-dependent protein binding; calmodulin binding; metal ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EEA1 Products

Required fields are marked with *

My Review for All EEA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon