Recombinant Human EEA1

• Cat.No.: EEA1-28464TH
• Product Overview: Recombinant fragment of Human EEA1 with a proprietary tag: predicted molecular weight 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: EEA1 is Early Endosome Antigen 1 protein that binds phospholipid vesicles containing phosphatidylinositol 3-phosphate, which is necessary for endosomal trafficking.
• Molecular Weight: 36.630kDa inclusive of tags
• Biological activity: This product is useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG
• Sequence Similarities: Contains 1 C2H2-type zinc finger.Contains 1 FYVE-type zinc finger.

Gene Information

• Gene Name: EEA1 early endosome antigen 1 [ Homo sapiens ]
• Official Symbol: EEA1
• Synonyms: EEA1; early endosome antigen 1; early endosome antigen 1, 162kD; ZFYVE2
• Gene ID: 8411
• mRNA Refseq: NM_003566
• Protein Refseq: NP_003557
• MIM: 605070
• Uniprot ID: Q15075
• Chromosome Location: 12q22
• Pathway: Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Phagosome, organism-specific biosystem
• Function: 1-phosphatidylinositol binding; GTP-dependent protein binding; calmodulin binding; metal ion binding; protein binding