Recombinant Human EEA1
Cat.No. : | EEA1-28464TH |
Product Overview : | Recombinant fragment of Human EEA1 with a proprietary tag: predicted molecular weight 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | EEA1 is Early Endosome Antigen 1 protein that binds phospholipid vesicles containing phosphatidylinositol 3-phosphate, which is necessary for endosomal trafficking. |
Molecular Weight : | 36.630kDa inclusive of tags |
Biological activity : | This product is useful for Antibody Production and Protein Array |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KVLELQRKLDNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVRVCDACFNDLQG |
Sequence Similarities : | Contains 1 C2H2-type zinc finger.Contains 1 FYVE-type zinc finger. |
Gene Name | EEA1 early endosome antigen 1 [ Homo sapiens ] |
Official Symbol | EEA1 |
Synonyms | EEA1; early endosome antigen 1; early endosome antigen 1, 162kD; ZFYVE2; |
Gene ID | 8411 |
mRNA Refseq | NM_003566 |
Protein Refseq | NP_003557 |
MIM | 605070 |
Uniprot ID | Q15075 |
Chromosome Location | 12q22 |
Pathway | Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Immune System, organism-specific biosystem; Innate Immune System, organism-specific biosystem; Phagosome, organism-specific biosystem; |
Function | 1-phosphatidylinositol binding; GTP-dependent protein binding; calmodulin binding; metal ion binding; protein binding; |
◆ Recombinant Proteins | ||
EEA1-28464TH | Recombinant Human EEA1 | +Inquiry |
EEA1-3902H | Recombinant Human EEA1 protein, His-tagged | +Inquiry |
EEA1-9389HFL | Recombinant Full Length Human EEA1 protein, Flag-tagged | +Inquiry |
EEA1-301519H | Recombinant Human EEA1 protein, GST-tagged | +Inquiry |
EEA1-8789H | Recombinant Human EEA1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EEA1 Products
Required fields are marked with *
My Review for All EEA1 Products
Required fields are marked with *
0
Inquiry Basket