Recombinant Human EEF1B2 protein, GST-tagged
| Cat.No. : | EEF1B2-4000H |
| Product Overview : | Recombinant Human EEF1B2 protein(P24534)(1-225aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-225aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.6 kDa |
| AA Sequence : | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens ] |
| Official Symbol | EEF1B2 |
| Synonyms | EEF1B2; eukaryotic translation elongation factor 1 beta 2; elongation factor 1-beta; EF-1-beta; eukaryotic translation elongation factor 1 beta 1; EF1B; EEF1B; EEF1B1; |
| Gene ID | 1933 |
| mRNA Refseq | NM_001037663 |
| Protein Refseq | NP_001032752 |
| MIM | 600655 |
| UniProt ID | P24534 |
| ◆ Recombinant Proteins | ||
| EEF1B2-6463C | Recombinant Chicken EEF1B2 | +Inquiry |
| Eef1b2-2736M | Recombinant Mouse Eef1b2 Protein, Myc/DDK-tagged | +Inquiry |
| EEF1B2-3069H | Recombinant Human EEF1B2 Protein, GST-tagged | +Inquiry |
| EEF1B2-5455H | Recombinant Human EEF1B2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EEF1B2-1383R | Recombinant Rhesus monkey EEF1B2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EEF1B2-6714HCL | Recombinant Human EEF1B2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1B2 Products
Required fields are marked with *
My Review for All EEF1B2 Products
Required fields are marked with *
