Recombinant Human EEF1B2 Protein, His-tagged

Cat.No. : EEF1B2-3460H
Product Overview : Recombinant human EEF1B2 protein (1-225 aa), fused to His-tag at C-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 233
Description : This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.
Form : Liquid
Molecular Mass : 25.8 kDa
AA Sequence : MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKILEHHHHHH
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 100mM NaCl
Gene Name EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens (human) ]
Official Symbol EEF1B2
Synonyms EEF1B2; eukaryotic translation elongation factor 1 beta 2; elongation factor 1-beta; EF-1-beta; eukaryotic translation elongation factor 1 beta 1
Gene ID 1933
mRNA Refseq NM_021121
Protein Refseq NP_066944
MIM 600655
UniProt ID P24534

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All E Products

Required fields are marked with *

My Review for All E Products

Required fields are marked with *

0
cart-icon