Recombinant Human EEF1B2 Protein, His-tagged
Cat.No. : | EEF1B2-3460H |
Product Overview : | Recombinant human EEF1B2 protein (1-225 aa), fused to His-tag at C-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 233 |
Description : | This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. |
Form : | Liquid |
Molecular Mass : | 25.8 kDa |
AA Sequence : | MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKILEHHHHHH |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 1mM DTT, 100mM NaCl |
Gene Name | EEF1B2 eukaryotic translation elongation factor 1 beta 2 [ Homo sapiens (human) ] |
Official Symbol | EEF1B2 |
Synonyms | EEF1B2; eukaryotic translation elongation factor 1 beta 2; elongation factor 1-beta; EF-1-beta; eukaryotic translation elongation factor 1 beta 1 |
Gene ID | 1933 |
mRNA Refseq | NM_021121 |
Protein Refseq | NP_066944 |
MIM | 600655 |
UniProt ID | P24534 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All E Products
Required fields are marked with *
My Review for All E Products
Required fields are marked with *
0
Inquiry Basket