Recombinant Human EGFL7 Protein, His tagged
| Cat.No. : | EGFL7-001H |
| Product Overview : | Recombinant Human EGFL7 Protein (21-273 aa) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-273 aa |
| Description : | This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants. |
| Molecular Mass : | 29 kDa |
| Purity : | > 90% by SDS-PAGE |
| AA Sequence : | MEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDSHHHHHHHH |
| Endotoxin : | < 1.0 EU/μg by LAL |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH6.5, 10% Glycerol, 8% Trehalose |
| Concentration : | 1 mg/mL by BCA |
| Gene Name | EGFL7 EGF like domain multiple 7 [ Homo sapiens (human) ] |
| Official Symbol | EGFL7 |
| Synonyms | EGFL7; EGF-like-domain, multiple 7; epidermal growth factor-like protein 7; ZNEU1; EGF-like protein 7; NOTCH4-like protein; vascular endothelial statin; multiple EGF-like domains protein 7; multiple epidermal growth factor-like domains protein 7; NEU1; VE-STATIN; RP11-251M1.2; MGC111117 |
| Gene ID | 51162 |
| mRNA Refseq | NM_016215 |
| Protein Refseq | NP_057299 |
| MIM | 608582 |
| UniProt ID | Q9UHF1 |
| ◆ Recombinant Proteins | ||
| EGFL7-1694H | Recombinant Human EGFL7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| EGFL7-1375H | Recombinant Human EGFL7 Protein, MYC/DDK-tagged | +Inquiry |
| EGFL7-1873H | Recombinant Human EGFL7 protein, His & T7-tagged | +Inquiry |
| Egfl7-1874M | Recombinant Mouse Egfl7 protein, His & T7-tagged | +Inquiry |
| EGFL7-1220R | Recombinant Rhesus Macaque EGFL7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGFL7-649HCL | Recombinant Human EGFL7 cell lysate | +Inquiry |
| EGFL7-565MCL | Recombinant Mouse EGFL7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFL7 Products
Required fields are marked with *
My Review for All EGFL7 Products
Required fields are marked with *
