Recombinant Human EGFL7 Protein, His tagged

Cat.No. : EGFL7-001H
Product Overview : Recombinant Human EGFL7 Protein (21-273 aa) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-273 aa
Description : This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants.
Molecular Mass : 29 kDa
Purity : > 90% by SDS-PAGE
AA Sequence : MEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDSHHHHHHHH
Endotoxin : < 1.0 EU/μg by LAL
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH6.5, 10% Glycerol, 8% Trehalose
Concentration : 1 mg/mL by BCA
Gene Name EGFL7 EGF like domain multiple 7 [ Homo sapiens (human) ]
Official Symbol EGFL7
Synonyms EGFL7; EGF-like-domain, multiple 7; epidermal growth factor-like protein 7; ZNEU1; EGF-like protein 7; NOTCH4-like protein; vascular endothelial statin; multiple EGF-like domains protein 7; multiple epidermal growth factor-like domains protein 7; NEU1; VE-STATIN; RP11-251M1.2; MGC111117
Gene ID 51162
mRNA Refseq NM_016215
Protein Refseq NP_057299
MIM 608582
UniProt ID Q9UHF1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EGFL7 Products

Required fields are marked with *

My Review for All EGFL7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon