Recombinant Human EGFL7 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | EGFL7-1694H |
| Product Overview : | EGFL7 MS Standard C13 and N15-labeled recombinant protein (NP_057299) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants. |
| Molecular Mass : | 29.4 kDa |
| AA Sequence : | MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDSSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | EGFL7 EGF like domain multiple 7 [ Homo sapiens (human) ] |
| Official Symbol | EGFL7 |
| Synonyms | EGFL7; EGF-like-domain, multiple 7; epidermal growth factor-like protein 7; ZNEU1; EGF-like protein 7; NOTCH4-like protein; vascular endothelial statin; multiple EGF-like domains protein 7; multiple epidermal growth factor-like domains protein 7; NEU1; VE-STATIN; RP11-251M1.2; MGC111117; |
| Gene ID | 51162 |
| mRNA Refseq | NM_016215 |
| Protein Refseq | NP_057299 |
| MIM | 608582 |
| UniProt ID | Q9UHF1 |
| ◆ Recombinant Proteins | ||
| EGFL7-2027R | Recombinant Rat EGFL7 Protein | +Inquiry |
| EGFL7-1873H | Recombinant Human EGFL7 protein, His & T7-tagged | +Inquiry |
| EGFL7-4256HF | Recombinant Full Length Human EGFL7 Protein, GST-tagged | +Inquiry |
| EGFL7-3802Z | Recombinant Zebrafish EGFL7 | +Inquiry |
| EGFL7-2127H | Recombinant Human EGFL7 Protein (Tyr24-Ser273), N-His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGFL7-565MCL | Recombinant Mouse EGFL7 cell lysate | +Inquiry |
| EGFL7-649HCL | Recombinant Human EGFL7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFL7 Products
Required fields are marked with *
My Review for All EGFL7 Products
Required fields are marked with *



