Recombinant Human EGFL7 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EGFL7-1694H |
Product Overview : | EGFL7 MS Standard C13 and N15-labeled recombinant protein (NP_057299) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a secreted endothelial cell protein that contains two epidermal growth factor-like domains. The encoded protein may play a role in regulating vasculogenesis. This protein may be involved in the growth and proliferation of tumor cells. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 29.4 kDa |
AA Sequence : | MRGSQEVLLMWLLVLAVGGTEHAYRPGRRVCAVRAHGDPVSESFVQRVYQPFLTTCDGHRACSTYRTIYRTAYRRSPGLAPARPRYACCPGWKRTSGLPGACGAAICQPPCRNGGSCVQPGRCRCPAGWRGDTCQSDVDECSARRGGCPQRCVNTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDSSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EGFL7 EGF like domain multiple 7 [ Homo sapiens (human) ] |
Official Symbol | EGFL7 |
Synonyms | EGFL7; EGF-like-domain, multiple 7; epidermal growth factor-like protein 7; ZNEU1; EGF-like protein 7; NOTCH4-like protein; vascular endothelial statin; multiple EGF-like domains protein 7; multiple epidermal growth factor-like domains protein 7; NEU1; VE-STATIN; RP11-251M1.2; MGC111117; |
Gene ID | 51162 |
mRNA Refseq | NM_016215 |
Protein Refseq | NP_057299 |
MIM | 608582 |
UniProt ID | Q9UHF1 |
◆ Recombinant Proteins | ||
EGFL7-3115H | Recombinant Human EGFL7 Protein, GST-tagged | +Inquiry |
EGFL7-3077H | Active Recombinant Human EGFL7 protein(Tyr24-Ser273), His-tagged | +Inquiry |
EGFL7-1684R | Recombinant Rat EGFL7 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGFL7-3802Z | Recombinant Zebrafish EGFL7 | +Inquiry |
Egfl7-1874M | Recombinant Mouse Egfl7 protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
EGFL7-001H | Recombinant Human EGFL7 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGFL7-565MCL | Recombinant Mouse EGFL7 cell lysate | +Inquiry |
EGFL7-649HCL | Recombinant Human EGFL7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFL7 Products
Required fields are marked with *
My Review for All EGFL7 Products
Required fields are marked with *