Recombinant Human EGFR Protein, Fc-tagged, Alexa Fluor 647 conjugated
| Cat.No. : | EGFR-629HAF647 |
| Product Overview : | Recombinant Human EGFR Protein (25-378aa), was expressed in HEK293 with C-terminal Fc tag and Alexa Fluor 647 conjugate. |
| Availability | September 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 25-378 aa |
| Form : | Lyophilized |
| AA Sequence : | LEEKKGNYVVTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNI KHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFE NLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQ KTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVE NSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKYADAGHV CHLCHPNCTYGCTGPGLEGCPTNGPKIPSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK |
| Endotoxin : | < 0.1 ng/ μg (1 EU/ μg). |
| Purity : | > 95 % as determined by SDS-PAGE |
| Characteristic : | Disulfide-linked homodimer Labeled with Alexa Fluor 647 via amines Excitation = 650 nm Emission = 668 nm |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 4 months. |
| Storage Buffer : | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/mL. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Shipping : | The product is shipped at ambient temperature. |
| Conjugation : | Alexa Fluor 647 |
| Gene Name | EGFR epidermal growth factor receptor [ Homo sapiens ] |
| Official Symbol | EGFR |
| Synonyms | EGFR; epidermal growth factor receptor; epidermal growth factor receptor (avian erythroblastic leukemia viral (v erb b) oncogene homolog) , ERBB; ERBB1; erythroblastic leukemia viral (v erb b) oncogene homolog (avian); proto-oncogene c-ErbB-1; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; receptor tyrosine-protein kinase erbB-1; avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; ERBB; HER1; mENA; PIG61; |
| Gene ID | 1956 |
| mRNA Refseq | NM_201283 |
| Protein Refseq | NP_958440 |
| MIM | 131550 |
| UniProt ID | P00533 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGFR Products
Required fields are marked with *
My Review for All EGFR Products
Required fields are marked with *
