Recombinant human EGLN1, GST tagged

Cat.No. : EGLN1-126H
Product Overview : Recombinant human EGLN1 full-length ORF ( AAH05369.1, 1 a.a. - 128 a.a.) was expressed in Wheat Germ, with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. HIF is a transcriptional complex that plays a central role in mammalian oxygen homeostasis. This protein functions as a cellular oxygen sensor, and under normal oxygen concentration, modification by prolyl hydroxylation is a key regulatory event that targets HIF subunits for proteasomal destruction via the von Hippel-Lindau ubiquitylation complex. Mutations in this gene are associated with erythrocytosis familial type 3 (ECYT3).
Form : Liquid
Molecular Mass : 41 kDa
AA Sequence : MVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNP HEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EGLN1 egl nine homolog 1 (C. elegans) [ Homo sapiens ]
Official Symbol EGLN1
Synonyms EGLN1; egl nine homolog 1 (C. elegans); C1orf12, EGL nine (C.elegans) homolog 1; egl nine homolog 1; HIF prolyl hydroxylase 2; HIFPH2; PHD2; SM 20; ZMYND6; egl nine-like protein 1; HIF-prolyl hydroxylase 2; zinc finger MYND domain-containing protein 6; hypoxia-inducible factor prolyl hydroxylase 2; prolyl hydroxylase domain-containing protein 2; HPH2; SM20; ECYT3; HPH-2; C1orf12; HIF-PH2; DKFZp761F179;
Gene ID 54583
mRNA Refseq NM_022051
Protein Refseq NP_071334
MIM 606425
UniProt ID Q9GZT9
Chromosome Location 1q42.1
Pathway HIF-1-alpha transcription factor network, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Renal cell carcinoma, organism-specific biosystem; Renal cell carcinoma, conserved biosystem;
Function L-ascorbic acid binding; iron ion binding; metal ion binding; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen; peptidyl-proline dioxygenase activity; protein binding; zinc ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EGLN1 Products

Required fields are marked with *

My Review for All EGLN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon