Recombinant human EGLN1, GST tagged
Cat.No. : | EGLN1-126H |
Product Overview : | Recombinant human EGLN1 full-length ORF ( AAH05369.1, 1 a.a. - 128 a.a.) was expressed in Wheat Germ, with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. HIF is a transcriptional complex that plays a central role in mammalian oxygen homeostasis. This protein functions as a cellular oxygen sensor, and under normal oxygen concentration, modification by prolyl hydroxylation is a key regulatory event that targets HIF subunits for proteasomal destruction via the von Hippel-Lindau ubiquitylation complex. Mutations in this gene are associated with erythrocytosis familial type 3 (ECYT3). |
Form : | Liquid |
Molecular Mass : | 41 kDa |
AA Sequence : | MVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNP HEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EGLN1 egl nine homolog 1 (C. elegans) [ Homo sapiens ] |
Official Symbol | EGLN1 |
Synonyms | EGLN1; egl nine homolog 1 (C. elegans); C1orf12, EGL nine (C.elegans) homolog 1; egl nine homolog 1; HIF prolyl hydroxylase 2; HIFPH2; PHD2; SM 20; ZMYND6; egl nine-like protein 1; HIF-prolyl hydroxylase 2; zinc finger MYND domain-containing protein 6; hypoxia-inducible factor prolyl hydroxylase 2; prolyl hydroxylase domain-containing protein 2; HPH2; SM20; ECYT3; HPH-2; C1orf12; HIF-PH2; DKFZp761F179; |
Gene ID | 54583 |
mRNA Refseq | NM_022051 |
Protein Refseq | NP_071334 |
MIM | 606425 |
UniProt ID | Q9GZT9 |
Chromosome Location | 1q42.1 |
Pathway | HIF-1-alpha transcription factor network, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Renal cell carcinoma, organism-specific biosystem; Renal cell carcinoma, conserved biosystem; |
Function | L-ascorbic acid binding; iron ion binding; metal ion binding; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen; peptidyl-proline dioxygenase activity; protein binding; zinc ion binding; |
◆ Recombinant Proteins | ||
EGLN1-4080H | Recombinant Human EGLN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EGLN1-5049M | Recombinant Mouse EGLN1 Protein | +Inquiry |
EGLN1-4796H | Recombinant Human EGLN1 protein, His-tagged | +Inquiry |
EGLN1-126H | Recombinant human EGLN1, GST tagged | +Inquiry |
EGLN1-414H | Recombinant Human EGLN1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGLN1-6696HCL | Recombinant Human EGLN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGLN1 Products
Required fields are marked with *
My Review for All EGLN1 Products
Required fields are marked with *