Recombinant human EGLN1, GST tagged
| Cat.No. : | EGLN1-126H |
| Product Overview : | Recombinant human EGLN1 full-length ORF ( AAH05369.1, 1 a.a. - 128 a.a.) was expressed in Wheat Germ, with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. HIF is a transcriptional complex that plays a central role in mammalian oxygen homeostasis. This protein functions as a cellular oxygen sensor, and under normal oxygen concentration, modification by prolyl hydroxylation is a key regulatory event that targets HIF subunits for proteasomal destruction via the von Hippel-Lindau ubiquitylation complex. Mutations in this gene are associated with erythrocytosis familial type 3 (ECYT3). |
| Form : | Liquid |
| Molecular Mass : | 41 kDa |
| AA Sequence : | MVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNP HEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EGLN1 egl nine homolog 1 (C. elegans) [ Homo sapiens ] |
| Official Symbol | EGLN1 |
| Synonyms | EGLN1; egl nine homolog 1 (C. elegans); C1orf12, EGL nine (C.elegans) homolog 1; egl nine homolog 1; HIF prolyl hydroxylase 2; HIFPH2; PHD2; SM 20; ZMYND6; egl nine-like protein 1; HIF-prolyl hydroxylase 2; zinc finger MYND domain-containing protein 6; hypoxia-inducible factor prolyl hydroxylase 2; prolyl hydroxylase domain-containing protein 2; HPH2; SM20; ECYT3; HPH-2; C1orf12; HIF-PH2; DKFZp761F179; |
| Gene ID | 54583 |
| mRNA Refseq | NM_022051 |
| Protein Refseq | NP_071334 |
| MIM | 606425 |
| UniProt ID | Q9GZT9 |
| Chromosome Location | 1q42.1 |
| Pathway | HIF-1-alpha transcription factor network, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Renal cell carcinoma, organism-specific biosystem; Renal cell carcinoma, conserved biosystem; |
| Function | L-ascorbic acid binding; iron ion binding; metal ion binding; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen; peptidyl-proline dioxygenase activity; protein binding; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| EGLN1-4080H | Recombinant Human EGLN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Egln1-497M | Recombinant Mouse Egln1 Protein, MYC/DDK-tagged | +Inquiry |
| EGLN1-2680M | Recombinant Mouse EGLN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EGLN1-12326H | Recombinant Human EGLN1 protein, His-tagged | +Inquiry |
| EGLN1-001H | Recombinant Human EGLN1 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGLN1-6696HCL | Recombinant Human EGLN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGLN1 Products
Required fields are marked with *
My Review for All EGLN1 Products
Required fields are marked with *
