Recombinant Human EGLN1 protein, His-tagged
Cat.No. : | EGLN1-4796H |
Product Overview : | Recombinant Human EGLN1 protein(Q9GZT9)(177-426aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 177-426aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF |
Gene Name | EGLN1 egl nine homolog 1 (C. elegans) [ Homo sapiens ] |
Official Symbol | EGLN1 |
Synonyms | EGLN1; egl nine homolog 1 (C. elegans); C1orf12, EGL nine (C.elegans) homolog 1; egl nine homolog 1; HIF prolyl hydroxylase 2; HIFPH2; PHD2; SM 20; ZMYND6; egl nine-like protein 1; HIF-prolyl hydroxylase 2; zinc finger MYND domain-containing protein 6; hypoxia-inducible factor prolyl hydroxylase 2; prolyl hydroxylase domain-containing protein 2; HPH2; SM20; ECYT3; HPH-2; C1orf12; HIF-PH2; DKFZp761F179 |
Gene ID | 54583 |
mRNA Refseq | NM_022051 |
Protein Refseq | NP_071334 |
MIM | 606425 |
UniProt ID | Q9GZT9 |
◆ Recombinant Proteins | ||
EGLN1-127H | Recombinant Human EGLN1, MYC/DDK-tagged | +Inquiry |
EGLN1-4080H | Recombinant Human EGLN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EGLN1-12325H | Recombinant Human EGLN1, GST-tagged | +Inquiry |
EGLN1-12326H | Recombinant Human EGLN1 protein, His-tagged | +Inquiry |
EGLN1-5049M | Recombinant Mouse EGLN1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGLN1-6696HCL | Recombinant Human EGLN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGLN1 Products
Required fields are marked with *
My Review for All EGLN1 Products
Required fields are marked with *