Recombinant Human EGLN1 protein, His-tagged

Cat.No. : EGLN1-4796H
Product Overview : Recombinant Human EGLN1 protein(Q9GZT9)(177-426aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 177-426aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.9 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : GGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF
Gene Name EGLN1 egl nine homolog 1 (C. elegans) [ Homo sapiens ]
Official Symbol EGLN1
Synonyms EGLN1; egl nine homolog 1 (C. elegans); C1orf12, EGL nine (C.elegans) homolog 1; egl nine homolog 1; HIF prolyl hydroxylase 2; HIFPH2; PHD2; SM 20; ZMYND6; egl nine-like protein 1; HIF-prolyl hydroxylase 2; zinc finger MYND domain-containing protein 6; hypoxia-inducible factor prolyl hydroxylase 2; prolyl hydroxylase domain-containing protein 2; HPH2; SM20; ECYT3; HPH-2; C1orf12; HIF-PH2; DKFZp761F179
Gene ID 54583
mRNA Refseq NM_022051
Protein Refseq NP_071334
MIM 606425
UniProt ID Q9GZT9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All EGLN1 Products

Required fields are marked with *

My Review for All EGLN1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon