Recombinant Human EGLN3 Protein, GST-tagged
Cat.No. : | EGLN3-3119H |
Product Overview : | Human EGLN3 full-length ORF ( NP_071356.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | EGLN3 (Egl-9 Family Hypoxia Inducible Factor 3) is a Protein Coding gene. Diseases associated with EGLN3 include Hypoxia and Chronic Mountain Sickness. Among its related pathways are CDK-mediated phosphorylation and removal of Cdc6 and Development HGF signaling pathway. GO annotations related to this gene include oxidoreductase activity and oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen. An important paralog of this gene is EGLN2. |
Molecular Mass : | 53.7 kDa |
AA Sequence : | MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHCTGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAISFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGILRIFPEGKSFIADVEPIFDRLLFFWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALTED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EGLN3 egl nine homolog 3 (C. elegans) [ Homo sapiens ] |
Official Symbol | EGLN3 |
Synonyms | EGLN3; egl nine homolog 3 (C. elegans); EGL nine (C.elegans) homolog 3; egl nine homolog 3; HIF prolyl hydroxylase 3; HIFPH3; PHD3; HPH-1; HPH-3; HIF-PH3; HIF-prolyl hydroxylase 3; egl nine-like protein 3 isoform; hypoxia-inducible factor prolyl hydroxylase 3; prolyl hydroxylase domain-containing protein 3; FLJ21620; MGC125998; MGC125999; |
Gene ID | 112399 |
mRNA Refseq | NM_022073 |
Protein Refseq | NP_071356 |
MIM | 606426 |
UniProt ID | Q9H6Z9 |
◆ Recombinant Proteins | ||
EGLN3-1223R | Recombinant Rhesus Macaque EGLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGLN3-2681M | Recombinant Mouse EGLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGLN3-3119H | Recombinant Human EGLN3 Protein, GST-tagged | +Inquiry |
EGLN3-812H | Recombinant Human EGLN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
EGLN3-4262HF | Recombinant Full Length Human EGLN3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EGLN3-6693HCL | Recombinant Human EGLN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EGLN3 Products
Required fields are marked with *
My Review for All EGLN3 Products
Required fields are marked with *
0
Inquiry Basket