Recombinant Human EGR3 protein, His-tagged
| Cat.No. : | EGR3-2855H |
| Product Overview : | Recombinant Human EGR3 protein(1-186 aa), fused to His tag, was expressed in E. coli. |
| Availability | June 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-186 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSN |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | EGR3 early growth response 3 [ Homo sapiens ] |
| Official Symbol | EGR3 |
| Synonyms | EGR3; early growth response 3; early growth response protein 3; PILOT; zinc finger protein pilot; EGR-3; MGC138484; |
| Gene ID | 1960 |
| mRNA Refseq | NM_001199880 |
| Protein Refseq | NP_001186809 |
| MIM | 602419 |
| UniProt ID | Q06889 |
| ◆ Recombinant Proteins | ||
| EGR3-3125H | Recombinant Human EGR3 Protein, GST-tagged | +Inquiry |
| Egr3-2762M | Recombinant Mouse Egr3 Protein, Myc/DDK-tagged | +Inquiry |
| EGR3-2034R | Recombinant Rat EGR3 Protein | +Inquiry |
| EGR3-2050H | Recombinant Human EGR3 Protein (Cys98-Ala363), N-His tagged | +Inquiry |
| EGR3-2684M | Recombinant Mouse EGR3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EGR3-243HCL | Recombinant Human EGR3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EGR3 Products
Required fields are marked with *
My Review for All EGR3 Products
Required fields are marked with *
