Recombinant Human EHF Protein, GST-tagged
Cat.No. : | EHF-3133H |
Product Overview : | Human EHF full-length ORF ( NP_036285.2, 1 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein that belongs to an ETS transcription factor subfamily characterized by epithelial-specific expression (ESEs). The encoded protein acts as a transcriptional repressor and may be involved in epithelial differentiation and carcinogenesis. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
Molecular Mass : | 61.3 kDa |
AA Sequence : | MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGQCSSDLFQSTHNVIVKTEQTEPSIMNTWKDENYLYDTNYGSTVDLLDSKTFCRAQISMTTTSHLPVAESPDMKKEQDPPAKCHTKKHNPRGTHLWEFIRDILLNPDKNPGLIKWEDRSEGVFRFLKSEAVAQLWGKKKNNSSMTYEKLSRAMRYYYKREILERVDGRRLVYKFGKNARGWRENEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EHF ets homologous factor [ Homo sapiens ] |
Official Symbol | EHF |
Synonyms | EHF; ets homologous factor; ETS homologous factor; epithelium specific ets factor 3; ESE3; ESE3 transcription factor; ESEJ; hEHF; ETS domain-containing transcription factor; epithelium-specific Ets transcription factor 3; ESE3B; |
Gene ID | 26298 |
mRNA Refseq | NM_001206615 |
Protein Refseq | NP_001193544 |
MIM | 605439 |
UniProt ID | Q9NZC4 |
◆ Recombinant Proteins | ||
Ehf-4017M | Recombinant Mouse Ehf Protein (Ile2-Asn127), C-His tagged | +Inquiry |
Ehf-5649M | Recombinant Mouse Ehf Protein (Met1-Asn127), C-His tagged | +Inquiry |
EHF-4967C | Recombinant Chicken EHF | +Inquiry |
EHF-544H | Recombinant Human ets homologous factor, His-tagged | +Inquiry |
EHF-3133H | Recombinant Human EHF Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EHF-6687HCL | Recombinant Human EHF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EHF Products
Required fields are marked with *
My Review for All EHF Products
Required fields are marked with *