Recombinant Human EID1 Protein, GST-tagged
| Cat.No. : | EID1-1871H |
| Product Overview : | Human CRI1 full-length ORF ( NP_055150.1, 1 a.a. - 187 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | EID1 (EP300 Interacting Inhibitor Of Differentiation 1) is a Protein Coding gene. GO annotations related to this gene include transcription corepressor activity and histone acetyltransferase regulator activity. |
| Molecular Mass : | 47.3 kDa |
| AA Sequence : | MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPEGKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTREPALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EID1 EP300 interacting inhibitor of differentiation 1 [ Homo sapiens ] |
| Official Symbol | EID1 |
| Synonyms | EID1; EP300 interacting inhibitor of differentiation 1; C15orf3, CREBBP/EP300 inhibitor 1 , CREBBP/EP300 inhibitory protein 1 , CRI1; EP300-interacting inhibitor of differentiation 1; EID 1; CREBBP/EP300 inhibitor 1; 21 kDa pRb-associated protein; NB4 apoptosis related protein; CREBBP/EP300 inhibitory protein 1; Rb- and p300-binding protein EID-1; E1A-like inhibitor of differentiation 1; retinoblastoma protein-associated protein; CRI1; EID-1; RBP21; PTD014; C15orf3; PNAS-22; IRO45620; MGC138883; MGC138884; |
| Gene ID | 23741 |
| mRNA Refseq | NM_014335 |
| Protein Refseq | NP_055150 |
| MIM | 605894 |
| UniProt ID | Q9Y6B2 |
| ◆ Recombinant Proteins | ||
| EID1-5066M | Recombinant Mouse EID1 Protein | +Inquiry |
| EID1-2692M | Recombinant Mouse EID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EID1-1407R | Recombinant Rhesus monkey EID1 Protein, His-tagged | +Inquiry |
| EID1-1232R | Recombinant Rhesus Macaque EID1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EID1-12340H | Recombinant Human EID1, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EID1-6682HCL | Recombinant Human EID1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EID1 Products
Required fields are marked with *
My Review for All EID1 Products
Required fields are marked with *
