Recombinant Human EIF1AX Protein, GST-tagged

• Cat.No.: EIF1AX-3141H
• Product Overview: Human EIF1AX full-length ORF ( AAH00793, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq, Jul 2008]
• Molecular Mass: 41.58 kDa
• AA Sequence: MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EIF1AX eukaryotic translation initiation factor 1A, X chromosome [ Homo sapiens ]
• Official Symbol: EIF1AX
• Synonyms: EIF1AX; eukaryotic translation initiation factor 1A, X chromosome; EIF1A; EIF4C
• Gene ID: 1964
• mRNA Refseq: NM_001412
• Protein Refseq: NP_001403
• MIM: 300186
• UniProt ID: P47813