Recombinant Human EIF1AX Protein, GST-tagged
Cat.No. : | EIF1AX-3141H |
Product Overview : | Human EIF1AX full-length ORF ( AAH00793, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an essential eukaryotic translation initiation factor. The protein is required for the binding of the 43S complex (a 40S subunit, eIF2/GTP/Met-tRNAi and eIF3) to the 5' end of capped RNA. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 41.58 kDa |
AA Sequence : | MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDTFGPGDDDEIQFDDIGDDDEDIDDI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EIF1AX eukaryotic translation initiation factor 1A, X chromosome [ Homo sapiens ] |
Official Symbol | EIF1AX |
Synonyms | EIF1AX; eukaryotic translation initiation factor 1A, X chromosome; EIF1A; EIF4C; |
Gene ID | 1964 |
mRNA Refseq | NM_001412 |
Protein Refseq | NP_001403 |
MIM | 300186 |
UniProt ID | P47813 |
◆ Recombinant Proteins | ||
EIF1AX-1236R | Recombinant Rhesus Macaque EIF1AX Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF1AX-3141H | Recombinant Human EIF1AX Protein, GST-tagged | +Inquiry |
EIF1AX-1063H | Recombinant Human EIF1AX Protein (M1-I144), His tagged | +Inquiry |
EIF1AX-1411R | Recombinant Rhesus monkey EIF1AX Protein, His-tagged | +Inquiry |
EIF1AX-2051H | Recombinant Human EIF1AX Protein (Met1-Ile144), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF1AX-6677HCL | Recombinant Human EIF1AX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF1AX Products
Required fields are marked with *
My Review for All EIF1AX Products
Required fields are marked with *