Recombinant Human EIF3F Protein, His-tagged

Cat.No. : EIF3F-274H
Product Overview : Recombinant human EIF3F protein (380aa), fused to His-tag at N-terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : Ubiquitous expression in ovary (RPKM 140.6), lymph node (RPKM 83.6) and 25 other tissues.
Form : Liquid
Molecular Mass : 40 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSMATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Denatured
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M urea
Gene Name EIF3F eukaryotic translation initiation factor 3 subunit F [ Homo sapiens (human) ]
Official Symbol EIF3F
Synonyms EIF3F; eukaryotic translation initiation factor 3 subunit F; MRT67; EIF3S5; eIF3-p47; eukaryotic translation initiation factor 3 subunit F; deubiquitinating enzyme eIF3f; eIF-3-epsilon; eIF3-epsilon; eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD); eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; EC 3.4.19.12
Gene ID 8665
mRNA Refseq NM_003754
Protein Refseq NP_003745
MIM 603914
UniProt ID O00303

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF3F Products

Required fields are marked with *

My Review for All EIF3F Products

Required fields are marked with *

0

Inquiry Basket

cartIcon