Recombinant Human EIF3F Protein, His-tagged
Cat.No. : | EIF3F-274H |
Product Overview : | Recombinant human EIF3F protein (380aa), fused to His-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Ubiquitous expression in ovary (RPKM 140.6), lymph node (RPKM 83.6) and 25 other tissues. |
Form : | Liquid |
Molecular Mass : | 40 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPAQTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL |
Purity : | > 90% by SDS-PAGE |
Applications : | SDS-PAGE, Denatured |
Storage : | Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M urea |
Gene Name | EIF3F eukaryotic translation initiation factor 3 subunit F [ Homo sapiens (human) ] |
Official Symbol | EIF3F |
Synonyms | EIF3F; eukaryotic translation initiation factor 3 subunit F; MRT67; EIF3S5; eIF3-p47; eukaryotic translation initiation factor 3 subunit F; deubiquitinating enzyme eIF3f; eIF-3-epsilon; eIF3-epsilon; eukaryotic translation initiation factor 3, subunit 5 (epsilon, 47kD); eukaryotic translation initiation factor 3, subunit 5 epsilon, 47kDa; EC 3.4.19.12 |
Gene ID | 8665 |
mRNA Refseq | NM_003754 |
Protein Refseq | NP_003745 |
MIM | 603914 |
UniProt ID | O00303 |
◆ Recombinant Proteins | ||
EIF3F-486C | Recombinant Cynomolgus EIF3F Protein, His-tagged | +Inquiry |
EIF3F-231C | Recombinant Cynomolgus Monkey EIF3F Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3F-824H | Recombinant Human EIF3F Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3F-2049HFL | Recombinant Full Length Human EIF3F Protein, C-Flag-tagged | +Inquiry |
EIF3F-3255H | Recombinant Human EIF3F protein(Ala2~Leu357), His-TRxA-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3F-6661HCL | Recombinant Human EIF3F 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3F Products
Required fields are marked with *
My Review for All EIF3F Products
Required fields are marked with *
0
Inquiry Basket