Recombinant Human EIF3M Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EIF3M-3020H |
Product Overview : | EIF3M MS Standard C13 and N15-labeled recombinant protein (NP_006351) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has been shown to interfere with translation of herpes virus mRNAs by preventing the association of mRNAs with the ribosomes. A pseudogene of this gene is located on the X chromosome. |
Molecular Mass : | 42.5 kDa |
AA Sequence : | MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EIF3M eukaryotic translation initiation factor 3 subunit M [ Homo sapiens (human) ] |
Official Symbol | EIF3M |
Synonyms | EIF3M; eukaryotic translation initiation factor 3, subunit M; PCI domain containing 1 (herpesvirus entry mediator), PCID1; eukaryotic translation initiation factor 3 subunit M; eIF3m; FLJ29030; GA17; hfl B5; B5 receptor; fetal lung protein B5; dendritic cell protein; PCI domain-containing protein 1; PCI domain containing 1 (herpesvirus entry mediator); B5; PCID1; hfl-B5; |
Gene ID | 10480 |
mRNA Refseq | NM_006360 |
Protein Refseq | NP_006351 |
MIM | 609641 |
UniProt ID | Q7L2H7 |
◆ Recombinant Proteins | ||
EIF3M-1548C | Recombinant Chicken EIF3M | +Inquiry |
EIF3M-2715M | Recombinant Mouse EIF3M Protein, His (Fc)-Avi-tagged | +Inquiry |
EIF3M-3057Z | Recombinant Zebrafish EIF3M | +Inquiry |
EIF3M-3020H | Recombinant Human EIF3M Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF3M-637HF | Recombinant Full Length Human EIF3M Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF3M-6655HCL | Recombinant Human EIF3M 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF3M Products
Required fields are marked with *
My Review for All EIF3M Products
Required fields are marked with *