Recombinant Human EIF4E2 protein, His-tagged
| Cat.No. : | EIF4E2-155H |
| Product Overview : | Recombinant Human EIF4E2 protein(O60573)(1-245aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-245aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.3 kDa |
| AASequence : | MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | EIF4E2 eukaryotic translation initiation factor 4E family member 2 [ Homo sapiens ] |
| Official Symbol | EIF4E2 |
| Synonyms | EIF4E2; eukaryotic translation initiation factor 4E family member 2; EIF4EL3, eukaryotic translation initiation factor 4E like 3; eukaryotic translation initiation factor 4E type 2; 4EHP; IF4e; eIF4E type 2; eIF-4E type 2; eIF4E-like protein 4E-LP; mRNA cap-binding protein 4EHP; eIF4E-like cap-binding protein; mRNA cap-binding protein type 3; eukaryotic translation initiation factor 4E-like 3; eukaryotic translation initiation factor 4E member 2; eukaryotic translation initiation factor 4E homologous protein; 4E-LP; EIF4EL3; |
| Gene ID | 9470 |
| mRNA Refseq | NM_004846 |
| Protein Refseq | NP_004837 |
| MIM | 605895 |
| UniProt ID | O60573 |
| ◆ Recombinant Proteins | ||
| EIF4E2-1253R | Recombinant Rhesus Macaque EIF4E2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Eif4e2-2787M | Recombinant Mouse Eif4e2 Protein, Myc/DDK-tagged | +Inquiry |
| EIF4E2-2032HFL | Recombinant Full Length Human EIF4E2 Protein, C-Flag-tagged | +Inquiry |
| EIF4E2-01H | Recombinant Human EIF4E2 protein, Myc/DDK-tagged | +Inquiry |
| EIF4E2-28495TH | Recombinant Human EIF4E2, T7 -tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EIF4E2-6650HCL | Recombinant Human EIF4E2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4E2 Products
Required fields are marked with *
My Review for All EIF4E2 Products
Required fields are marked with *
