Recombinant Human EIF4E2 protein, His-tagged

Cat.No. : EIF4E2-155H
Product Overview : Recombinant Human EIF4E2 protein(O60573)(1-245aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-245aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 35.3 kDa
AASequence : MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name EIF4E2 eukaryotic translation initiation factor 4E family member 2 [ Homo sapiens ]
Official Symbol EIF4E2
Synonyms EIF4E2; eukaryotic translation initiation factor 4E family member 2; EIF4EL3, eukaryotic translation initiation factor 4E like 3; eukaryotic translation initiation factor 4E type 2; 4EHP; IF4e; eIF4E type 2; eIF-4E type 2; eIF4E-like protein 4E-LP; mRNA cap-binding protein 4EHP; eIF4E-like cap-binding protein; mRNA cap-binding protein type 3; eukaryotic translation initiation factor 4E-like 3; eukaryotic translation initiation factor 4E member 2; eukaryotic translation initiation factor 4E homologous protein; 4E-LP; EIF4EL3;
Gene ID 9470
mRNA Refseq NM_004846
Protein Refseq NP_004837
MIM 605895
UniProt ID O60573

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4E2 Products

Required fields are marked with *

My Review for All EIF4E2 Products

Required fields are marked with *

0
cart-icon
0
compare icon