Recombinant Human EIF4EBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EIF4EBP2-5173H
Product Overview : EIF4EBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004087) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection.
Molecular Mass : 12.9 kDa
AA Sequence : MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens (human) ]
Official Symbol EIF4EBP2
Synonyms EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2; eukaryotic translation initiation factor 4E-binding protein 2; 4E-BP2; eIF4E-binding protein 2; phosphorylated, heat and acid stable regulated by insulin protein II; 4EBP2; PHASII;
Gene ID 1979
mRNA Refseq NM_004096
Protein Refseq NP_004087
MIM 602224
UniProt ID Q13542

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4EBP2 Products

Required fields are marked with *

My Review for All EIF4EBP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon