Recombinant Human EIF4EBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EIF4EBP2-5173H |
Product Overview : | EIF4EBP2 MS Standard C13 and N15-labeled recombinant protein (NP_004087) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the eukaryotic translation initiation factor 4E binding protein family. The gene products of this family bind eIF4E and inhibit translation initiation. However, insulin and other growth factors can release this inhibition via a phosphorylation-dependent disruption of their binding to eIF4E. Regulation of protein production through these gene products have been implicated in cell proliferation, cell differentiation and viral infection. |
Molecular Mass : | 12.9 kDa |
AA Sequence : | MSSSAGSGHQPSQSRAIPTRTVAISDAAQLPHDYCTTPGGTLFSTTPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGTLIEDSKVEVNNLNNLNNHDRKHAVGDDAQFEMDITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EIF4EBP2 eukaryotic translation initiation factor 4E binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | EIF4EBP2 |
Synonyms | EIF4EBP2; eukaryotic translation initiation factor 4E binding protein 2; eukaryotic translation initiation factor 4E-binding protein 2; 4E-BP2; eIF4E-binding protein 2; phosphorylated, heat and acid stable regulated by insulin protein II; 4EBP2; PHASII; |
Gene ID | 1979 |
mRNA Refseq | NM_004096 |
Protein Refseq | NP_004087 |
MIM | 602224 |
UniProt ID | Q13542 |
◆ Recombinant Proteins | ||
EIF4EBP2-28493TH | Recombinant Human EIF4EBP2, His-tagged | +Inquiry |
EIF4EBP2-2843H | Recombinant Human EIF4EBP2 protein, GST-tagged | +Inquiry |
EIF4EBP2-5173H | Recombinant Human EIF4EBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
EIF4EBP2-4999H | Recombinant Human Eukaryotic Translation Initiation Factor 4E Binding Protein 2, His-tagged | +Inquiry |
EIF4EBP2-5111M | Recombinant Mouse EIF4EBP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4EBP2-6648HCL | Recombinant Human EIF4EBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP2 Products
Required fields are marked with *
My Review for All EIF4EBP2 Products
Required fields are marked with *