Recombinant Human EIF4EBP3 Protein (1-100 aa), His-SUMO-tagged

• Cat.No.: EIF4EBP3-476H
• Product Overview: Recombinant Human EIF4EBP3 Protein (1-100 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-100 aa
• Description: Repressor of translation initiation that regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 26.9 kDa
• AA Sequence: MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 3 [ Homo sapiens ]
• Official Symbol: EIF4EBP3
• Synonyms: EIF4EBP3; 4E BP3; 4EBP3; 4E-BP3
• Gene ID: 8637
• mRNA Refseq: NM_003732
• Protein Refseq: NP_003723
• MIM: 603483
• UniProt ID: O60516