Recombinant Human EIF4EBP3 Protein (1-100 aa), His-SUMO-tagged
Cat.No. : | EIF4EBP3-476H |
Product Overview : | Recombinant Human EIF4EBP3 Protein (1-100 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-100 aa |
Description : | Repressor of translation initiation that regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 26.9 kDa |
AA Sequence : | MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 3 [ Homo sapiens ] |
Official Symbol | EIF4EBP3 |
Synonyms | EIF4EBP3; 4E BP3; 4EBP3; 4E-BP3; |
Gene ID | 8637 |
mRNA Refseq | NM_003732 |
Protein Refseq | NP_003723 |
MIM | 603483 |
UniProt ID | O60516 |
◆ Recombinant Proteins | ||
Eif4ebp3-362M | Recombinant Mouse Eif4ebp3 Protein, MYC/DDK-tagged | +Inquiry |
EIF4EBP3-4296HF | Recombinant Full Length Human EIF4EBP3 Protein, GST-tagged | +Inquiry |
EIF4EBP3-476H | Recombinant Human EIF4EBP3 Protein (1-100 aa), His-SUMO-tagged | +Inquiry |
EIF4EBP3-1743Z | Recombinant Zebrafish EIF4EBP3 | +Inquiry |
EIF4EBP3-301288H | Recombinant Human EIF4EBP3 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EIF4EBP3-6647HCL | Recombinant Human EIF4EBP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP3 Products
Required fields are marked with *
My Review for All EIF4EBP3 Products
Required fields are marked with *