Recombinant Human EIF4EBP3 Protein (1-100 aa), His-SUMO-tagged

Cat.No. : EIF4EBP3-476H
Product Overview : Recombinant Human EIF4EBP3 Protein (1-100 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-100 aa
Description : Repressor of translation initiation that regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 26.9 kDa
AA Sequence : MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 3 [ Homo sapiens ]
Official Symbol EIF4EBP3
Synonyms EIF4EBP3; 4E BP3; 4EBP3; 4E-BP3;
Gene ID 8637
mRNA Refseq NM_003732
Protein Refseq NP_003723
MIM 603483
UniProt ID O60516

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4EBP3 Products

Required fields are marked with *

My Review for All EIF4EBP3 Products

Required fields are marked with *

0
cart-icon