Recombinant Human EIF4EBP3 Protein (1-100 aa), His-SUMO-tagged
| Cat.No. : | EIF4EBP3-476H |
| Product Overview : | Recombinant Human EIF4EBP3 Protein (1-100 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-100 aa |
| Description : | Repressor of translation initiation that regulates EIF4E activity by preventing its assbly into the eIF4F complex: hypophosphorylated form competes with EIF4G1/EIF4G3 and strongly binds to EIF4E, leading to repress translation. In contrast, hyperphosphorylated form dissociates from EIF4E, allowing interaction between EIF4G1/EIF4G3 and EIF4E, leading to initiation of translation. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 26.9 kDa |
| AA Sequence : | MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | EIF4EBP3 eukaryotic translation initiation factor 4E binding protein 3 [ Homo sapiens ] |
| Official Symbol | EIF4EBP3 |
| Synonyms | EIF4EBP3; 4E BP3; 4EBP3; 4E-BP3; |
| Gene ID | 8637 |
| mRNA Refseq | NM_003732 |
| Protein Refseq | NP_003723 |
| MIM | 603483 |
| UniProt ID | O60516 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EIF4EBP3 Products
Required fields are marked with *
My Review for All EIF4EBP3 Products
Required fields are marked with *




