Recombinant Human ELAVL1(1-100aa), GST-tagged
| Cat.No. : | ELAVL1-02H |
| Product Overview : | Recombinant Human ELAVL1 partial ORF (1 a.a. - 100 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ELAV-like protein 1 or HuR (human antigen R) is a protein that in humans is encoded by the ELAVL1 gene. The protein encoded by this gene is a member of the ELAVL protein family. This encoded protein contains 3 RNA-binding domains and binds cis-acting AU-rich elements. It stabilizes mRNAs and thereby regulates gene expression. |
| Predicted MolecularMass : | 36.74 kDa |
| AminoAcid Sequence : | MSNGYEDHMAEDCRGDIGRTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAE RAINTLNGLRLQSKTIKVSYARPSS |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Applications : | ELISA; WB |
| Stability& Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| OfficialSymbol : | ELAVL1 |
| Gene Name | ELAVL1 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R) [ Homo sapiens ] |
| Synonyms | ELAVL1; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 1 (Hu antigen R); HUR; Hua; MelG; ELAV1; ELAV-like protein 1; Hu antigen R; hu-antigen R; embryonic lethal, abnormal vision, drosophila, homolog-like 1 |
| Gene ID | 1994 |
| mRNA Refseq | NM_001419 |
| Protein Refseq | NP_001410 |
| MIM | 603466 |
| UniProt ID | Q15717 |
| Chromosome Location | 19p13.2 |
| Pathway | Gene Expression; Regulation of mRNA Stability by Proteins that Bind AU-rich Elements; Stabilization of mRNA by HuR |
| Function | AU-rich element binding; RNA binding; mRNA binding; nucleotide binding; protein binding; tein kinase binding |
| ◆ Recombinant Proteins | ||
| ELAVL1-02H | Recombinant Human ELAVL1(1-100aa), GST-tagged | +Inquiry |
| ELAVL1-145HF | Recombinant Full Length Human ELAVL1 Protein, GST-tagged | +Inquiry |
| ELAVL1-76HFL | Recombinant Full Length Human ELAVL1 Protein, GST-tagged | +Inquiry |
| ELAVL1-9020Z | Recombinant Zebrafish ELAVL1 | +Inquiry |
| ELAVL1-5123M | Recombinant Mouse ELAVL1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ELAVL1-154HKCL | Human ELAVL1 Knockdown Cell Lysate | +Inquiry |
| ELAVL1-6637HCL | Recombinant Human ELAVL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELAVL1 Products
Required fields are marked with *
My Review for All ELAVL1 Products
Required fields are marked with *


