"ELF2" Related Products

Expand
Expand

Recombinant Human ELF2 protein, T7/His-tagged

Cat.No.: ELF2-158H
Product Overview: Recombinant human ELF2 cDNA (533aa, Isoform-II) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.40 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGEFELATSLHEGPTNQLDLLIRAVEASVHSSNAHCTDKTIEAAEALLHME SPTCLRDSRSPVEVFVPPCVSTPEFIHAAMRPDVITETVVEVSTEESEPMDTSPIPTSPDSHEPMKKKKVGRKPK TQQSPISNGSPELGIKKKPREGKGNTTYLWEFLLDLLQDKNTCPRYIKWTQREKGIFKLVDSKAVSKLWGKHKNK PDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKDMPKNIVVIDDDKSETCNEDLAGTTDEKSLERVSLSAESLL KAASSVRSGKNSSPINCSRAEKGVARVVNITSPGHDASSRSPTTTASVSATAAPRTVRVAMQVPVVMTSLGQKIS TVAVQSVNAGAPLITSTSPTTATSPKVVIQTIPTVMPASTENGDKITMQPAKIITIPATQLAQCQLQTKSNLTGS GSINIVGTPLAVRALTPVSIAHGTPVMRLSMPTQQASGQTPPRVISAVIKGPEVKSEAVAKKQEHDVKTLQLVEE KPADGNKTVTHVVVVSAPSAIALPVTMKTEGLVTCEK
Purity: >90% by SDS-PAGE
Applications: 1. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.2. May be used for ELF2 protein-protein interaction mapping.3. As immunogen for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: ELF2 E74-like factor 2 (ets domain transcription factor) [ Homo sapiens ]
Official Symbol: ELF2
Synonyms: ELF2; EU32; NERF; NERF 1A; NERF 1B; NERF 2; new Ets-related factor; NERF-2; NERF-1A; NERF-1B; NERF-1a,b;
Gene ID: 1998
mRNA Refseq: NM_006874
Protein Refseq: NP_006865
MIM:
UniProt ID: Q15723
Chromosome Location: 4q28
Pathway: Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem;
Function: protein binding; sequence-specific DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.