Recombinant Human ELF3
Cat.No. : | ELF3-27972TH |
Product Overview : | Recombinant fragment of Human ESE1 with N terminal proprietary tag, 37.73kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Expressed exclusively in tissues containing a high content of terminally differentiated epithelial cells including mammary gland, colon, trachea, kidney, prostate, uterus, stomach and skin. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEG VFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREI LERVDGRRLVYKFGKNSSGWKEEEVLQSRN |
Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain.Contains 1 PNT (pointed) domain. |
Gene Name | ELF3 E74-like factor 3 (ets domain transcription factor, epithelial-specific ) [ Homo sapiens ] |
Official Symbol | ELF3 |
Synonyms | ELF3; E74-like factor 3 (ets domain transcription factor, epithelial-specific ); ESX; ETS-related transcription factor Elf-3; EPR 1; ERT; ESE 1; |
Gene ID | 1999 |
mRNA Refseq | NM_001114309 |
Protein Refseq | NP_001107781 |
MIM | 602191 |
Uniprot ID | P78545 |
Chromosome Location | 1q32.2 |
Pathway | EGFR1 Signaling Pathway, organism-specific biosystem; |
Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; |
◆ Recombinant Proteins | ||
Elf3-2797M | Recombinant Mouse Elf3 Protein, Myc/DDK-tagged | +Inquiry |
ELF3-5212H | Recombinant Human ELF3 protein | +Inquiry |
ELF3-4348HF | Recombinant Full Length Human ELF3 Protein, GST-tagged | +Inquiry |
ELF3-2734M | Recombinant Mouse ELF3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELF3-2434H | Recombinant Human ELF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELF3-6632HCL | Recombinant Human ELF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELF3 Products
Required fields are marked with *
My Review for All ELF3 Products
Required fields are marked with *