Recombinant Human ELF3
| Cat.No. : | ELF3-27972TH |
| Product Overview : | Recombinant fragment of Human ESE1 with N terminal proprietary tag, 37.73kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Tissue specificity : | Expressed exclusively in tissues containing a high content of terminally differentiated epithelial cells including mammary gland, colon, trachea, kidney, prostate, uterus, stomach and skin. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | EGKKSKHAPRGTHLWEFIRDILIHPELNEGLMKWENRHEG VFKFLRSEAVAQLWGQKKKNSNMTYEKLSRAMRYYYKREI LERVDGRRLVYKFGKNSSGWKEEEVLQSRN |
| Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain.Contains 1 PNT (pointed) domain. |
| Gene Name | ELF3 E74-like factor 3 (ets domain transcription factor, epithelial-specific ) [ Homo sapiens ] |
| Official Symbol | ELF3 |
| Synonyms | ELF3; E74-like factor 3 (ets domain transcription factor, epithelial-specific ); ESX; ETS-related transcription factor Elf-3; EPR 1; ERT; ESE 1; |
| Gene ID | 1999 |
| mRNA Refseq | NM_001114309 |
| Protein Refseq | NP_001107781 |
| MIM | 602191 |
| Uniprot ID | P78545 |
| Chromosome Location | 1q32.2 |
| Pathway | EGFR1 Signaling Pathway, organism-specific biosystem; |
| Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription coactivator activity; |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELF3 Products
Required fields are marked with *
My Review for All ELF3 Products
Required fields are marked with *
