Recombinant Human ELK4

Cat.No. : ELK4-28290TH
Product Overview : Recombinant fragment corresponding to amino acids 118-206 of Human ELK4 with an N terminal proprietary tag; predicted mwt: 35.42 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 89 amino acids
Description : This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene.
Molecular Weight : 35.420kDa
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : KDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAA
Sequence Similarities : Belongs to the ETS family.Contains 1 ETS DNA-binding domain.
Gene Name ELK4 ELK4, ETS-domain protein (SRF accessory protein 1) [ Homo sapiens ]
Official Symbol ELK4
Synonyms ELK4; ELK4, ETS-domain protein (SRF accessory protein 1); ETS domain-containing protein Elk-4; SAP1;
Gene ID 2005
mRNA Refseq NM_001973
Protein Refseq NP_001964
MIM 600246
Uniprot ID P28324
Chromosome Location 1q32
Pathway EGFR1 Signaling Pathway, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Id Signaling Pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem;
Function DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription cofactor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELK4 Products

Required fields are marked with *

My Review for All ELK4 Products

Required fields are marked with *

0
cart-icon
0
compare icon