Recombinant Human ELK4
Cat.No. : | ELK4-28290TH |
Product Overview : | Recombinant fragment corresponding to amino acids 118-206 of Human ELK4 with an N terminal proprietary tag; predicted mwt: 35.42 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 89 amino acids |
Description : | This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. |
Molecular Weight : | 35.420kDa |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAA |
Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain. |
Gene Name | ELK4 ELK4, ETS-domain protein (SRF accessory protein 1) [ Homo sapiens ] |
Official Symbol | ELK4 |
Synonyms | ELK4; ELK4, ETS-domain protein (SRF accessory protein 1); ETS domain-containing protein Elk-4; SAP1; |
Gene ID | 2005 |
mRNA Refseq | NM_001973 |
Protein Refseq | NP_001964 |
MIM | 600246 |
Uniprot ID | P28324 |
Chromosome Location | 1q32 |
Pathway | EGFR1 Signaling Pathway, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Id Signaling Pathway, organism-specific biosystem; MAPK signaling pathway, organism-specific biosystem; |
Function | DNA binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; transcription cofactor activity; |
◆ Recombinant Proteins | ||
ELK4-2740M | Recombinant Mouse ELK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ELK4-780H | Recombinant Human ELK4 Protein, His-tagged | +Inquiry |
ELK4-28290TH | Recombinant Human ELK4 | +Inquiry |
ELK4-8571Z | Recombinant Zebrafish ELK4 | +Inquiry |
ELK4-1268R | Recombinant Rhesus Macaque ELK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELK4-6627HCL | Recombinant Human ELK4 293 Cell Lysate | +Inquiry |
ELK4-6628HCL | Recombinant Human ELK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELK4 Products
Required fields are marked with *
My Review for All ELK4 Products
Required fields are marked with *
0
Inquiry Basket