Recombinant Human ELK4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ELK4-523H |
Product Overview : | ELK4 MS Standard C13 and N15-labeled recombinant protein (NP_068567) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. |
Molecular Mass : | 44.7 kDa |
AA Sequence : | MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ELK4 ETS transcription factor ELK4 [ Homo sapiens (human) ] |
Official Symbol | ELK4 |
Synonyms | ELK4; ELK4, ETS-domain protein (SRF accessory protein 1); ETS domain-containing protein Elk-4; SAP1; SAP-1; serum response factor accessory protein 1; DKFZp434N185; |
Gene ID | 2005 |
mRNA Refseq | NM_021795 |
Protein Refseq | NP_068567 |
MIM | 600246 |
UniProt ID | P28324 |
◆ Recombinant Proteins | ||
ELK4-523H | Recombinant Human ELK4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Elk4-2799M | Recombinant Mouse Elk4 Protein, Myc/DDK-tagged | +Inquiry |
ELK4-5136M | Recombinant Mouse ELK4 Protein | +Inquiry |
ELK4-780H | Recombinant Human ELK4 Protein, His-tagged | +Inquiry |
ELK4-4354HF | Recombinant Full Length Human ELK4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELK4-6628HCL | Recombinant Human ELK4 293 Cell Lysate | +Inquiry |
ELK4-6627HCL | Recombinant Human ELK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELK4 Products
Required fields are marked with *
My Review for All ELK4 Products
Required fields are marked with *