Recombinant Human ELK4 Protein, GST-tagged
| Cat.No. : | ELK4-3246H |
| Product Overview : | Human ELK4 full-length ORF ( NP_068567.1, 1 a.a. - 405 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 71.1 kDa |
| AA Sequence : | MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKSPQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPTSASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEPKDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQVACSLFMVSPLLSFICPFKQIQNLYTQVCFLLLRFVLERLCVTVM |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ELK4 ELK4, ETS-domain protein (SRF accessory protein 1) [ Homo sapiens ] |
| Official Symbol | ELK4 |
| Synonyms | ELK4; ELK4, ETS-domain protein (SRF accessory protein 1); ETS domain-containing protein Elk-4; SAP1; SAP-1; serum response factor accessory protein 1; DKFZp434N185; |
| Gene ID | 2005 |
| mRNA Refseq | NM_001973 |
| Protein Refseq | NP_001964 |
| MIM | 600246 |
| UniProt ID | P28324 |
| ◆ Recombinant Proteins | ||
| ELK4-3246H | Recombinant Human ELK4 Protein, GST-tagged | +Inquiry |
| ELK4-5136M | Recombinant Mouse ELK4 Protein | +Inquiry |
| ELK4-8571Z | Recombinant Zebrafish ELK4 | +Inquiry |
| ELK4-1268R | Recombinant Rhesus Macaque ELK4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ELK4-523H | Recombinant Human ELK4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ELK4-6627HCL | Recombinant Human ELK4 293 Cell Lysate | +Inquiry |
| ELK4-6628HCL | Recombinant Human ELK4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELK4 Products
Required fields are marked with *
My Review for All ELK4 Products
Required fields are marked with *
