Recombinant Human ELMO2 protein, His-tagged

• Cat.No.: ELMO2-2780H
• Product Overview: Recombinant Human ELMO2 protein(1-60 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-60 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
• AASequence: MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: ELMO2 engulfment and cell motility 2 [ Homo sapiens ]
• Official Symbol: ELMO2
• Synonyms: ELMO2; engulfment and cell motility 2; engulfment and cell motility 2 (ced 12 homolog, C. elegans); engulfment and cell motility protein 2; CED 12; CED12; ELMO 2; FLJ11656; KIAA1834; hCed-12A; ced-12 homolog 2; PH domain protein CED12A; protein ced-12 homolog A; CED-12; ELMO-2
• Gene ID: 63916
• mRNA Refseq: NM_133171
• Protein Refseq: NP_573403
• MIM: 606421
• UniProt ID: Q96JJ3