Recombinant Human ELMOD1 Protein, GST-tagged
Cat.No. : | ELMOD1-3257H |
Product Overview : | Human ELMOD1 full-length ORF ( NP_061182.3, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ELMOD1 (ELMO Domain Containing 1) is a Protein Coding gene. GO annotations related to this gene include GTPase activator activity. An important paralog of this gene is ELMOD2. |
Molecular Mass : | 65.5 kDa |
AA Sequence : | MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELMOD1 ELMO/CED-12 domain containing 1 [ Homo sapiens ] |
Official Symbol | ELMOD1 |
Synonyms | ELMOD1; ELMO/CED-12 domain containing 1; ELMO domain containing 1; ELMO domain-containing protein 1; DKFZp547C176; |
Gene ID | 55531 |
mRNA Refseq | NM_001130037 |
Protein Refseq | NP_001123509 |
MIM | 615456 |
UniProt ID | Q8N336 |
◆ Recombinant Proteins | ||
ELMOD1-5152Z | Recombinant Zebrafish ELMOD1 | +Inquiry |
ELMOD1-1271R | Recombinant Rhesus Macaque ELMOD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Elmod1-2800M | Recombinant Mouse Elmod1 Protein, Myc/DDK-tagged | +Inquiry |
ELMOD1-1447R | Recombinant Rhesus monkey ELMOD1 Protein, His-tagged | +Inquiry |
ELMOD1-204H | Recombinant Human ELMOD1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELMOD1-6620HCL | Recombinant Human ELMOD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ELMOD1 Products
Required fields are marked with *
My Review for All ELMOD1 Products
Required fields are marked with *
0
Inquiry Basket