Recombinant Human EMC8 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EMC8-2844H |
Product Overview : | COX4NB MS Standard C13 and N15-labeled recombinant protein (NP_006058) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Belongs to the EMC8/EMC9 family. |
Molecular Mass : | 23.8 kDa |
AA Sequence : | MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EMC8 ER membrane protein complex subunit 8 [ Homo sapiens (human) ] |
Official Symbol | EMC8 |
Synonyms | EMC8; ER membrane protein complex subunit 8; NOC4; COX4NB; C16orf2; C16orf4; FAM158B; ER membrane protein complex subunit 8; COX4 neighbor; family with sequence similarity 158, member B; neighbor of COX4 |
Gene ID | 10328 |
mRNA Refseq | NM_006067 |
Protein Refseq | NP_006058 |
MIM | 604886 |
UniProt ID | O43402 |
◆ Recombinant Proteins | ||
EMC8-12549Z | Recombinant Zebrafish EMC8 | +Inquiry |
EMC8-1747H | Recombinant Human EMC8 Protein, GST-tagged | +Inquiry |
COX4NB-284H | Recombinant Human EMC8, His tagged | +Inquiry |
EMC8-2005HF | Recombinant Full Length Human EMC8 Protein, GST-tagged | +Inquiry |
EMC8-2844H | Recombinant Human EMC8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMC8 Products
Required fields are marked with *
My Review for All EMC8 Products
Required fields are marked with *