Recombinant Human EMC8 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : EMC8-2844H
Product Overview : COX4NB MS Standard C13 and N15-labeled recombinant protein (NP_006058) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Belongs to the EMC8/EMC9 family.
Molecular Mass : 23.8 kDa
AA Sequence : MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name EMC8 ER membrane protein complex subunit 8 [ Homo sapiens (human) ]
Official Symbol EMC8
Synonyms EMC8; ER membrane protein complex subunit 8; NOC4; COX4NB; C16orf2; C16orf4; FAM158B; ER membrane protein complex subunit 8; COX4 neighbor; family with sequence similarity 158, member B; neighbor of COX4
Gene ID 10328
mRNA Refseq NM_006067
Protein Refseq NP_006058
MIM 604886
UniProt ID O43402

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EMC8 Products

Required fields are marked with *

My Review for All EMC8 Products

Required fields are marked with *

0
cart-icon
0
compare icon