Recombinant Human EMC8 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | EMC8-2844H | 
| Product Overview : | COX4NB MS Standard C13 and N15-labeled recombinant protein (NP_006058) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | Belongs to the EMC8/EMC9 family. | 
| Molecular Mass : | 23.8 kDa | 
| AA Sequence : | MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLCTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | EMC8 ER membrane protein complex subunit 8 [ Homo sapiens (human) ] | 
| Official Symbol | EMC8 | 
| Synonyms | EMC8; ER membrane protein complex subunit 8; NOC4; COX4NB; C16orf2; C16orf4; FAM158B; ER membrane protein complex subunit 8; COX4 neighbor; family with sequence similarity 158, member B; neighbor of COX4 | 
| Gene ID | 10328 | 
| mRNA Refseq | NM_006067 | 
| Protein Refseq | NP_006058 | 
| MIM | 604886 | 
| UniProt ID | O43402 | 
| ◆ Recombinant Proteins | ||
| EMC8-12549Z | Recombinant Zebrafish EMC8 | +Inquiry | 
| EMC8-1747H | Recombinant Human EMC8 Protein, GST-tagged | +Inquiry | 
| COX4NB-284H | Recombinant Human EMC8, His tagged | +Inquiry | 
| EMC8-2005HF | Recombinant Full Length Human EMC8 Protein, GST-tagged | +Inquiry | 
| EMC8-2844H | Recombinant Human EMC8 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMC8 Products
Required fields are marked with *
My Review for All EMC8 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            