Recombinant Human EMR1 protein, GST-tagged
Cat.No. : | EMR1-7853H |
Product Overview : | Recombinant Human EMR1 protein(430-510 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 430-510 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | TEYLDIESKVINKECSEENVTLDLVAKGDKMKIGCSTIEESESTETTGVAFVSFVGMESVLNERFFKDHQAPLTTSEIKLK |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | EMR1 |
Synonyms | EMR1; egf-like module containing, mucin-like, hormone receptor-like 1; egf like module containing, mucin like, hormone receptor like sequence 1 , TM7LN3; EGF-like module-containing mucin-like hormone receptor-like 1; EMR1 hormone receptor; EGF-like module receptor 1; egf-like module containing, mucin-like, hormone receptor-like sequence 1; TM7LN3; |
Gene ID | 2015 |
mRNA Refseq | NM_001256252 |
Protein Refseq | NP_001243181 |
MIM | 600493 |
UniProt ID | Q14246 |
◆ Recombinant Proteins | ||
EMR1-3291H | Recombinant Human EMR1 Protein | +Inquiry |
EMR1-7854H | Recombinant Human EMR1 protein, His-tagged | +Inquiry |
EMR1-478H | Recombinant Human EMR1 | +Inquiry |
EMR1-7853H | Recombinant Human EMR1 protein, GST-tagged | +Inquiry |
EMR1-3292H | Recombinant Human EMR1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EMR1-554HCL | Recombinant Human EMR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EMR1 Products
Required fields are marked with *
My Review for All EMR1 Products
Required fields are marked with *
0
Inquiry Basket