Recombinant Human EN1 protein, GST-tagged

• Cat.No.: EN1-301198H
• Product Overview: Recombinant Human EN1 (109-197 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met109-Asn197
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MNILRPDFGCKKEQPPPQLLVAAAARGGAGGGGRVERDRGQTAAGRDPVHPLGTRAPGAASLLCAPDANCGPPDGSQPAAAGAGASKAGN
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: EN1 engrailed homeobox 1 [ Homo sapiens ]
• Official Symbol: EN1
• Synonyms: EN1; engrailed homeobox 1; homeobox protein engrailed-1; hu-En-1; engrailed homolog 1; homeobox protein en-1
• Gene ID: 2019
• mRNA Refseq: NM_001426
• Protein Refseq: NP_001417
• MIM: 131290
• UniProt ID: Q05925