Recombinant Human ENAH Protein, GST-tagged
Cat.No. : | ENAH-3299H |
Product Overview : | Human ENAH full-length ORF (BAC04736.1, 1 a.a. - 467 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the enabled/ vasodilator-stimulated phosphoprotein. Members of this gene family are involved in actin-based motility. This protein is involved in regulating the assembly of actin filaments and modulates cell adhesion and motility. Alternate splice variants of this gene have been correlated with tumor invasiveness in certain tissues and these variants may serve as prognostic markers. A pseudogene of this gene is found on chromosome 3. [provided by RefSeq, Sep 2016] |
Molecular Mass : | 78.8 kDa |
AA Sequence : | MMHALEVLNSQETGPTLPRQNSQLPAQVQNGPSQEELEIQRRQLQEQQRQKELERERLERERMERERLERERLERERLERERLEQEQLERERQERERQERLERQERLERQERLERQERLDRERQERQERERLERLERERQERERQEQLEREQLEWERERRISSAAAPASVETPLNSVLGDSSASEPGLQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLTGLAAAIAGAKLRKVSRMEDTSFPSGGNAIGVNSASSKADTGRGNGPLPLGGSGLMEEMSALLARRRRIAEKGSTIETEQKEDKGEDSEPVTSKASSTSTPEPTRKPWERTNTMNGSKSPVISRPKSTPLSQPSANGVQTEGLDYDRLKQDILDEMRKELTKLKEELIDAIRQELSKSNTA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ENAH enabled homolog (Drosophila) [ Homo sapiens ] |
Official Symbol | ENAH |
Synonyms | ENAH; enabled homolog (Drosophila); protein enabled homolog; FLJ10773; MENA; NDPP1; ENA; |
Gene ID | 55740 |
mRNA Refseq | NM_001008493 |
Protein Refseq | NP_001008493 |
MIM | 609061 |
UniProt ID | Q8N8S7 |
◆ Recombinant Proteins | ||
ENAH-3299H | Recombinant Human ENAH Protein, GST-tagged | +Inquiry |
ENAH-1505H | Recombinant Human ENAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Enah-2819M | Recombinant Mouse Enah Protein, Myc/DDK-tagged | +Inquiry |
ENAH-1818H | Recombinant Human ENAH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ENAH-3031H | Recombinant Human ENAH protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENAH Products
Required fields are marked with *
My Review for All ENAH Products
Required fields are marked with *