Recombinant Human Endothelial Cell-specific Molecule 1, His-tagged

• Cat.No.: ESM1-902H
• Product Overview: Recombinant Human ESM1 encoding the human mature ESM1 (Trp20-Arg184) with 6 His tag on the N-Terminus was expressed inE. Coli. This protein was purified by Ni-NTA column.MW=20KDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 20-184 a.a.
• Description: Endothelial cell-specific molecule 1 is a protein that in humans is encoded by the ESM1 gene. This gene encodes a secreted protein which is mainly expressed in the endothelial cells in human lung and kidney tissues. The expression of this gene is regulated by cytokines, suggesting that it may play a role in endothelium-dependent pathological disorders. The transcript contains multiple polyadenylation and mRNA instability signals.
• Sequence: Human mature ESM1 (Trp20-Arg184)20WSNNYAVDCPQHCDSSECKSSPRCKRTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPR184.
• Purity: >95% in SDS gel.
• Formulation: Lyophilized 100 μg humanmature ESM1 in 50 μl of TBS (20 mM Tris, 50mM NaCl, pH8.0). Carry free.
• Application: Cell biology, ELISA.
• Reconstitution: Add 500 μl deionized water to the vial to prepare a working stock solution at 200 μg/mL. Allow to set at least 30 minutes at 4°C, mix well.
• Storage: Store lyophilized protein at -20°C or -70°C. Lyophilized protein is stable for up to 6 months from date of receipt at -70°C. Upon reconstitution, this protein can be stored at for a few weeks or at -70°C in a manual defrost freezer for long term storage (six months). Aliquot reconstituted protein to avoid repeated freezing / thawing cycles.

Gene Information

• Gene Name: ESM1 endothelial cell-specific molecule 1 [ Homo sapiens ]
• Synonyms: ESM1; endothelial cell-specific molecule 1; endocan;ESM-1 secretory protein; ESM-1
• Gene ID: 11082
• mRNA Refseq: NM_001135604
• Protein Refseq: NP_001129076
• MIM: 601521
• UniProt ID: Q9NQ30
• Chromosome Location: 5q11
• Function: growth factor activity; insulin-like growth factor binding; protein binding