"ENDOU" Related Products

Recombinant Human ENDOU protein, T7/His-tagged

Cat.No.: ENDOU-222H
Product Overview: Recombinant human ENDOU cDNA (368aa, Isoform-II, derived from BC074729) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGEFRACISLVLAVLCGLAWAEDHKESEPLPQLEEETEEALASNLYSAPTS CQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLN SQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAV MKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLV DYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTW DKSTYGNGKKYIATAYIVSST
Purity: >90% by SDS-PAGE.
Applications: 1. May be used for in vitro ENDOU mediated placenta derived cell & tumor cells differentiation regulations study with this protein as either soluble factor or coating matrix protein.2. May be used for ENDOU protein-protein interaction mapping.3. Potential biomarker protein for clinical applications such as monitoring pancreatic cancer progression.4. As antigen for specific antibody production.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: ENDOU endonuclease, polyU-specific [ Homo sapiens (human) ]
Official Symbol: ENDOU
Synonyms: ENDOU; P11; PP11; PRSS26; endonuclease, polyU-specific; 22 serine protease; 26 serine protease; placental protein 11; uridylate-specific endoribonuclease; EC 3.1.-.-
Gene ID: 8909
mRNA Refseq: NM_001172439
Protein Refseq: NP_001165910
MIM: 606720
UniProt ID: P21128
Chromosome Location: 12q13.1
Function: RNA binding; endoribonuclease activity; growth factor activity
Products Types ◆ Recombinant Protein

◆ Lysates

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.