Recombinant Human ENDOU protein, T7/His-tagged

Cat.No. : ENDOU-222H
Product Overview : Recombinant human ENDOU cDNA (368aa, Isoform-II, derived from BC074729) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 368 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGHHHHHHGNLYFQGEFRACISLVLAVLCGLAWAEDHKESEPLPQLEEETEEALASNLYSAPTS CQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLN SQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAV MKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLV DYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTW DKSTYGNGKKYIATAYIVSST
Purity : >90% by SDS-PAGE.
Applications : 1. May be used for in vitro ENDOU mediated placenta derived cell & tumor cells differentiation regulations study with this protein as either soluble factor or coating matrix protein.2. May be used for ENDOU protein-protein interaction mapping.3. Potential biomarker protein for clinical applications such as monitoring pancreatic cancer progression.4. As antigen for specific antibody production.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name ENDOU endonuclease, polyU-specific [ Homo sapiens (human) ]
Official Symbol ENDOU
Synonyms ENDOU; P11; PP11; PRSS26; endonuclease, polyU-specific; 22 serine protease; 26 serine protease; placental protein 11; uridylate-specific endoribonuclease; EC 3.1.-.-
Gene ID 8909
mRNA Refseq NM_001172439
Protein Refseq NP_001165910
MIM 606720
UniProt ID P21128
Chromosome Location 12q13.1
Function RNA binding; endoribonuclease activity; growth factor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENDOU Products

Required fields are marked with *

My Review for All ENDOU Products

Required fields are marked with *

0
cart-icon
0
compare icon