Recombinant Human ENDOU protein, T7/His-tagged
Cat.No. : | ENDOU-222H |
Product Overview : | Recombinant human ENDOU cDNA (368aa, Isoform-II, derived from BC074729) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&T7 |
Protein Length : | 368 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
AA Sequence : | MASMTGGQQMGRGHHHHHHGNLYFQGEFRACISLVLAVLCGLAWAEDHKESEPLPQLEEETEEALASNLYSAPTS CQGRCYEAFDKHHQCHCNARCQEFGNCCKDFESLCSDHEVSHSSDAITKEEIQSISEKIYRADTNKAQKEDIVLN SQNCISPSETRNQVDRCPKPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQELAEQDAFLREIMKTAV MKELYSFLHHQNRYGSEQEFVDDLKNMWFGLYSRGNEEGDSSGFEHVFSGEVKKGKVTGFHNWIRFYLEEKEGLV DYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTW DKSTYGNGKKYIATAYIVSST |
Purity : | >90% by SDS-PAGE. |
Applications : | 1. May be used for in vitro ENDOU mediated placenta derived cell & tumor cells differentiation regulations study with this protein as either soluble factor or coating matrix protein.2. May be used for ENDOU protein-protein interaction mapping.3. Potential biomarker protein for clinical applications such as monitoring pancreatic cancer progression.4. As antigen for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days. |
Gene Name | ENDOU endonuclease, polyU-specific [ Homo sapiens (human) ] |
Official Symbol | ENDOU |
Synonyms | ENDOU; P11; PP11; PRSS26; endonuclease, polyU-specific; 22 serine protease; 26 serine protease; placental protein 11; uridylate-specific endoribonuclease; EC 3.1.-.- |
Gene ID | 8909 |
mRNA Refseq | NM_001172439 |
Protein Refseq | NP_001165910 |
MIM | 606720 |
UniProt ID | P21128 |
Chromosome Location | 12q13.1 |
Function | RNA binding; endoribonuclease activity; growth factor activity |
◆ Recombinant Proteins | ||
ENDOU-5198M | Recombinant Mouse ENDOU Protein | +Inquiry |
ENDOU-222H | Recombinant Human ENDOU protein, T7/His-tagged | +Inquiry |
Endou-2821M | Recombinant Mouse Endou Protein, Myc/DDK-tagged | +Inquiry |
ENDOU-5165Z | Recombinant Zebrafish ENDOU | +Inquiry |
ENDOU-2789M | Recombinant Mouse ENDOU Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENDOU-463HCL | Recombinant Human ENDOU lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENDOU Products
Required fields are marked with *
My Review for All ENDOU Products
Required fields are marked with *
0
Inquiry Basket