Recombinant Human ENO2 protein(191-370 aa), C-His-tagged
Cat.No. : | ENO2-2609H |
Product Overview : | Recombinant Human ENO2 protein(P09104)(191-370 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 191-370 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | TLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVS |
Gene Name | ENO2 enolase 2 (gamma, neuronal) [ Homo sapiens ] |
Official Symbol | ENO2 |
Synonyms | ENO2; enolase 2 (gamma, neuronal); gamma-enolase; neural enolase; neuron-specific enolase; neurone-specific enolase; neuron specific gamma enolase; 2-phospho-D-glycerate hydrolyase; 2-phospho-D-glycerate hydro-lyase; NSE; |
Gene ID | 2026 |
mRNA Refseq | NM_001975 |
Protein Refseq | NP_001966 |
MIM | 131360 |
UniProt ID | P09104 |
◆ Recombinant Proteins | ||
ENO2-1136Z | Recombinant Zebrafish ENO2 | +Inquiry |
ENO2-27576TH | Recombinant Human ENO2, His-tagged | +Inquiry |
ENO2-843H | Recombinant Human ENO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ENO2-4747H | Recombinant Human ENO2 protein, His-tagged | +Inquiry |
Eno2-125M | Active Recombinant Mouse Eno2 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ENO2-8235H | Native Human Brain Neuron Specific Enolase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENO2-6598HCL | Recombinant Human ENO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENO2 Products
Required fields are marked with *
My Review for All ENO2 Products
Required fields are marked with *