Recombinant Human ENO2 protein(191-370 aa), C-His-tagged

Cat.No. : ENO2-2609H
Product Overview : Recombinant Human ENO2 protein(P09104)(191-370 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 191-370 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : TLKGVIKDKYGKDATNVGDEGGFAPNILENSEALELVKEAIDKAGYTEKIVIGMDVAASEFYRDGKYDLDFKSPTDPSRYITGDQLGALYQDFVRDYPVVSIEDPFDQDDWAAWSKFTANVGIQIVGDDLTVTNPKRIERAVEEKACNCLLLKVNQIGSVTEAIQACKLAQENGWGVMVS
Gene Name ENO2 enolase 2 (gamma, neuronal) [ Homo sapiens ]
Official Symbol ENO2
Synonyms ENO2; enolase 2 (gamma, neuronal); gamma-enolase; neural enolase; neuron-specific enolase; neurone-specific enolase; neuron specific gamma enolase; 2-phospho-D-glycerate hydrolyase; 2-phospho-D-glycerate hydro-lyase; NSE;
Gene ID 2026
mRNA Refseq NM_001975
Protein Refseq NP_001966
MIM 131360
UniProt ID P09104

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENO2 Products

Required fields are marked with *

My Review for All ENO2 Products

Required fields are marked with *

0
cart-icon
0
compare icon