Recombinant Human ENO3
Cat.No. : | ENO3-28566TH |
Product Overview : | Recombinant full length Human ENO3 with N terminal proprietary tag; Predicted MWt 73.48 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 434 amino acids |
Description : | This gene encodes one of the three enolase isoenzymes found in mammals. This isoenzyme is found in skeletal muscle cells in the adult where it may play a role in muscle development and regeneration. A switch from alpha enolase to beta enolase occurs in muscle tissue during development in rodents. Mutations in this gene have be associated glycogen storage disease. Alternatively spliced transcript variants encoding different isoforms have been described. |
Molecular Weight : | 73.480kDa inclusive of tags |
Tissue specificity : | The alpha/alpha homodimer is expressed in embryo and in most adult tissues. The alpha/beta heterodimer and the beta/beta homodimer are found in striated muscle, and the alpha/gamma heterodimer and the gamma/gamma homodimer in neurons. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGAS TGIYEALELRDGDKGRYLGKGVLKAVENINSTLGPALLQK KLSVADQEKVDKFMIELDGTENKSKFGANAILGVSLAVCK AGAAEKGVPLYRHIADLAGNPDLILPVPAFNVINGGSHAG NKLAMQEFMILPVGASSFKEAMRIGAEVYHHLKGVIKAKY GKDATNVGDEGGFAPNILENNEALELLKTAIQAAGYPDKV VIGMDVAASEFYRNGKYDLDFKSPDDPARHITGEKLGELY KSFIKNYPVVSIEDPFDQDDWATWTSFLSGVNIQIVGDDL TVTNPKRIAQAVEKKACNCLLLKVNQIGSVTESIQACKLA QSNGWGVMVSHRSGETEDTFIADLVVGLCTGQIKTGAPCR SERLAKYNQLMRIEEALGDKAIFAGRKFRNPKAK |
Sequence Similarities : | Belongs to the enolase family. |
Gene Name | ENO3 enolase 3 (beta, muscle) [ Homo sapiens ] |
Official Symbol | ENO3 |
Synonyms | ENO3; enolase 3 (beta, muscle); enolase 3, (beta, muscle); beta-enolase; |
Gene ID | 2027 |
mRNA Refseq | NM_001193503 |
Protein Refseq | NP_001180432 |
MIM | 131370 |
Uniprot ID | P13929 |
Chromosome Location | 17pter-p11 |
Pathway | Gluconeogenesis, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, organism-specific biosystem; Gluconeogenesis, oxaloacetate => fructose-6P, conserved biosystem; |
Function | lyase activity; magnesium ion binding; phosphopyruvate hydratase activity; protein heterodimerization activity; protein homodimerization activity; |
◆ Recombinant Proteins | ||
ENO3-6954C | Recombinant Chicken ENO3 protein, His & GST-tagged | +Inquiry |
ENO3-12453H | Recombinant Human ENO3, GST-tagged | +Inquiry |
ENO3-3448H | Recombinant Human ENO3 protein, His-tagged | +Inquiry |
ENO3-149HF | Recombinant Full Length Human ENO3 Protein | +Inquiry |
ENO3-2885H | Recombinant Human ENO3 Protein (Met1-Gly391), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ENO3-248HCL | Recombinant Human ENO3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ENO3 Products
Required fields are marked with *
My Review for All ENO3 Products
Required fields are marked with *
0
Inquiry Basket