Recombinant Human ENPP3 Protein, GST-tagged

Cat.No. : ENPP3-3323H
Product Overview : Human ENPP3 partial ORF ( NP_005012, 602 a.a. - 699 a.a.) recombinant protein with GST-tag at N-terminal.
Availability February 07, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to a series of ectoenzymes that are involved in hydrolysis of extracellular nucleotides. These ectoenzymes possess ATPase and ATP pyrophosphatase activities and are type II transmembrane proteins. Expression of the related rat mRNA has been found in a subset of immature glial cells and in the alimentary tract. The corresponding rat protein has been detected in the pancreas, small intestine, colon, and liver. The human mRNA is expressed in glioma cells, prostate, and uterus. Expression of the human protein has been detected in uterus, basophils, and mast cells. Two transcript variants, one protein coding and the other non-protein coding, have been found for this gene. [provided by RefSeq, Oct 2015]
Molecular Mass : 36.52 kDa
AA Sequence : ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ENPP3 ectonucleotide pyrophosphatase/phosphodiesterase 3 [ Homo sapiens ]
Official Symbol ENPP3
Synonyms ENPP3; ectonucleotide pyrophosphatase/phosphodiesterase 3; PDNP3; ectonucleotide pyrophosphatase/phosphodiesterase family member 3; B10; CD203c; gp130RB13 6; PD IBETA; E-NPP 3; gp130RB13-6; phosphodiesterase I beta; phosphodiesterase-I beta; phosphodiesterase I/nucleotide pyrophosphatase 3; dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3); dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3); NPP3; PD-IBETA;
Gene ID 5169
mRNA Refseq NM_005021
Protein Refseq NP_005012
MIM 602182
UniProt ID O14638

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENPP3 Products

Required fields are marked with *

My Review for All ENPP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon