Recombinant Human ENPP3 Protein, GST-tagged
| Cat.No. : | ENPP3-3323H |
| Product Overview : | Human ENPP3 partial ORF ( NP_005012, 602 a.a. - 699 a.a.) recombinant protein with GST-tag at N-terminal. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene belongs to a series of ectoenzymes that are involved in hydrolysis of extracellular nucleotides. These ectoenzymes possess ATPase and ATP pyrophosphatase activities and are type II transmembrane proteins. Expression of the related rat mRNA has been found in a subset of immature glial cells and in the alimentary tract. The corresponding rat protein has been detected in the pancreas, small intestine, colon, and liver. The human mRNA is expressed in glioma cells, prostate, and uterus. Expression of the human protein has been detected in uterus, basophils, and mast cells. Two transcript variants, one protein coding and the other non-protein coding, have been found for this gene. [provided by RefSeq, Oct 2015] |
| Molecular Mass : | 36.52 kDa |
| AA Sequence : | ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ENPP3 ectonucleotide pyrophosphatase/phosphodiesterase 3 [ Homo sapiens ] |
| Official Symbol | ENPP3 |
| Synonyms | ENPP3; ectonucleotide pyrophosphatase/phosphodiesterase 3; PDNP3; ectonucleotide pyrophosphatase/phosphodiesterase family member 3; B10; CD203c; gp130RB13 6; PD IBETA; E-NPP 3; gp130RB13-6; phosphodiesterase I beta; phosphodiesterase-I beta; phosphodiesterase I/nucleotide pyrophosphatase 3; dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3); dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3); NPP3; PD-IBETA; |
| Gene ID | 5169 |
| mRNA Refseq | NM_005021 |
| Protein Refseq | NP_005012 |
| MIM | 602182 |
| UniProt ID | O14638 |
| ◆ Recombinant Proteins | ||
| ENPP3-215R | Recombinant Rhesus ENPP3 protein, His-tagged | +Inquiry |
| ENPP3-2105R | Recombinant Rat ENPP3 Protein | +Inquiry |
| Enpp3-2832M | Recombinant Mouse Enpp3 Protein, Myc/DDK-tagged | +Inquiry |
| ENPP3-1017H | Active Recombinant Human ENPP3 protein, His-tagged | +Inquiry |
| ENPP3-200HFL | Recombinant Full Length Human ENPP3 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ENPP3-001CCL | Recombinant Cynomolgus ENPP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENPP3 Products
Required fields are marked with *
My Review for All ENPP3 Products
Required fields are marked with *
