Recombinant Human ENTPD2 Protein, GST-tagged

Cat.No. : ENTPD2-3332H
Product Overview : Human ENTPD2 partial ORF ( NP_982293.1, 187 a.a. - 275 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is the type 2 enzyme of the ecto-nucleoside triphosphate diphosphohydrolase family (E-NTPDase). E-NTPDases are a family of ecto-nucleosidases that hydrolyze 5'-triphosphates. This ecto-ATPase is an integral membrane protein. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Molecular Mass : 35.53 kDa
AA Sequence : GRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ENTPD2 ectonucleoside triphosphate diphosphohydrolase 2 [ Homo sapiens ]
Official Symbol ENTPD2
Synonyms ENTPD2; ectonucleoside triphosphate diphosphohydrolase 2; CD39L1; CD39 like 1; ecto ATPase; NTPDase 2; ecto-ATPase 2; ecto-ATPDase 2; CD39 antigen-like 1; ecto-ATP diphosphohydrolase 2; NTPDase-2;
Gene ID 954
mRNA Refseq NM_001246
Protein Refseq NP_001237
MIM 602012
UniProt ID Q9Y5L3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ENTPD2 Products

Required fields are marked with *

My Review for All ENTPD2 Products

Required fields are marked with *

0
cart-icon