Recombinant Human ENY2 protein, His-tagged
| Cat.No. : | ENY2-5644H |
| Product Overview : | Recombinant Human ENY2 protein(Q9NPA8)(1-101aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-101aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.4 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MVVSKMNKDAQMRAAINQKLIETGERERLKELLRAKLIECGWKDQLKAHCKEVIKEKGLEHVTVDDLVAEITPKGRALVPDSVKKELLQRIRTFLAQHASL |
| Gene Name | ENY2 enhancer of yellow 2 homolog (Drosophila) [ Homo sapiens ] |
| Official Symbol | ENY2 |
| Synonyms | DC6; e(y)2 |
| Gene ID | 56943 |
| mRNA Refseq | NM_020189.5 |
| Protein Refseq | NP_064574.1 |
| UniProt ID | Q9NPA8 |
| ◆ Recombinant Proteins | ||
| ENY2-4340HF | Recombinant Full Length Human ENY2 Protein, GST-tagged | +Inquiry |
| ENY2-561Z | Recombinant Zebrafish ENY2 | +Inquiry |
| Eny2-2840M | Recombinant Mouse Eny2 Protein, Myc/DDK-tagged | +Inquiry |
| ENY2-4834C | Recombinant Chicken ENY2 | +Inquiry |
| ENY2-5226M | Recombinant Mouse ENY2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ENY2 Products
Required fields are marked with *
My Review for All ENY2 Products
Required fields are marked with *




