Recombinant Human EP300 Protein, GST-tagged

Cat.No. : EP300-3346H
Product Overview : Human EP300 partial ORF ( NP_001420, 731 a.a. - 830 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EP300 E1A binding protein p300 [ Homo sapiens ]
Official Symbol EP300
Synonyms EP300; E1A binding protein p300; histone acetyltransferase p300; KAT3B; p300; p300 HAT; E1A-binding protein, 300kD; E1A-associated protein p300; RSTS2;
Gene ID 2033
mRNA Refseq NM_001429
Protein Refseq NP_001420
MIM 602700
UniProt ID Q09472

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EP300 Products

Required fields are marked with *

My Review for All EP300 Products

Required fields are marked with *

0
cart-icon