Recombinant Human EP300 Protein, GST-tagged
Cat.No. : | EP300-3346H |
Product Overview : | Human EP300 partial ORF ( NP_001420, 731 a.a. - 830 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the adenovirus E1A-associated cellular p300 transcriptional co-activator protein. It functions as histone acetyltransferase that regulates transcription via chromatin remodeling and is important in the processes of cell proliferation and differentiation. It mediates cAMP-gene regulation by binding specifically to phosphorylated CREB protein. This gene has also been identified as a co-activator of HIF1A (hypoxia-inducible factor 1 alpha), and thus plays a role in the stimulation of hypoxia-induced genes such as VEGF. Defects in this gene are a cause of Rubinstein-Taybi syndrome and may also play a role in epithelial cancer. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PPLQHHGQLAQPGALNPPMGYGPRMQQPSNQGQFLPQTQFPSQGMNVTNIPLAPSSGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPQLPQPALHQN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EP300 E1A binding protein p300 [ Homo sapiens ] |
Official Symbol | EP300 |
Synonyms | EP300; E1A binding protein p300; histone acetyltransferase p300; KAT3B; p300; p300 HAT; E1A-binding protein, 300kD; E1A-associated protein p300; RSTS2; |
Gene ID | 2033 |
mRNA Refseq | NM_001429 |
Protein Refseq | NP_001420 |
MIM | 602700 |
UniProt ID | Q09472 |
◆ Recombinant Proteins | ||
EP300-3346H | Recombinant Human EP300 Protein, GST-tagged | +Inquiry |
EP300-04H | Recombinant Human EP300 Protein (catalytic domain, 965-1810), N-Flag-tagged | +Inquiry |
EP300-28680TH | Recombinant Human EP300, FLAG-tagged | +Inquiry |
EP300-1481R | Recombinant Monkey Ep300 Protein, His tagged | +Inquiry |
EP300-02H | Recombinant Human EP300 Protein, N-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EP300 Products
Required fields are marked with *
My Review for All EP300 Products
Required fields are marked with *