Recombinant Human EP400 Protein, GST-tagged

• Cat.No.: EP400-3347H
• Product Overview: Human EP400 partial ORF ( NP_056224.2, 743 a.a. - 850 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: EP400 (E1A Binding Protein P400) is a Protein Coding gene. Diseases associated with EP400 include Ossifying Fibromyxoid Tumor. Among its related pathways are Cellular Senescence and DNA Damage/Telomere Stress Induced Senescence. GO annotations related to this gene include chromatin binding and helicase activity. An important paralog of this gene is SRCAP.
• Molecular Mass: 37.62 kDa
• AA Sequence: QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAKKLVRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIECFWSNIEQV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EP400 E1A binding protein p400 [ Homo sapiens ]
• Official Symbol: EP400
• Synonyms: EP400; E1A binding protein p400; TNRC12, trinucleotide repeat containing 12; E1A-binding protein p400; CAGH32; DKFZP434I225; KIAA1498; KIAA1818; P400; hDomino; domino homolog; CAG repeat protein 32; p400 SWI2/SNF2-related protein; p400 kDa SWI2/SNF2-related protein; trinucleotide repeat containing 12; trinucleotide repeat-containing gene 12 protein; TNRC12; FLJ42018; FLJ45115
• Gene ID: 57634
• mRNA Refseq: NM_015409
• Protein Refseq: NP_056224
• MIM: 606265
• UniProt ID: Q96L91