Recombinant Human EPHA1 Protein, GST-tagged

Cat.No. : EPHA1-3375H
Product Overview : Human EPHA1 partial ORF ( NP_005223, 394 a.a. - 500 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene is expressed in some human cancer cell lines and has been implicated in carcinogenesis. [provided by RefSeq, Jul 2008]
Molecular Mass : 37.51 kDa
AA Sequence : PGARGLTTPAVHVNGLEPYANYTFNVEAQNGVSGLGSSGHASTSVSISMGHAESLSGLSLRLVKKEPRQLELTWAGSRPRSPGANLTYELHVLNQDEERYQMVLEPR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EPHA1 EPH receptor A1 [ Homo sapiens ]
Official Symbol EPHA1
Synonyms EPHA1; EPH receptor A1; EphA1 , EPHT, EPHT1; ephrin type-A receptor 1; EPH; hEpha1; oncogene EPH; eph tyrosine kinase 1; soluble EPHA1 variant 1; soluble EPHA1 variant 2; tyrosine-protein kinase receptor EPH; erythropoietin-producing hepatoma receptor; erythropoietin-producing hepatoma amplified sequence; EPHT; EPHT1; MGC163163;
Gene ID 2041
mRNA Refseq NM_005232
Protein Refseq NP_005223
MIM 179610
UniProt ID P21709

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPHA1 Products

Required fields are marked with *

My Review for All EPHA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon