Recombinant Human EPHB1 Protein, GST-tagged
| Cat.No. : | EPHB1-3399H |
| Product Overview : | Human EPHB1 partial ORF ( NP_004432.1, 221 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | ARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | EPHB1 EPH receptor B1 [ Homo sapiens ] |
| Official Symbol | EPHB1 |
| Synonyms | EPHB1; EPH receptor B1; EphB1 , EPHT2; ephrin type-B receptor 1; Hek6; EK6; EPH-like kinase 6; eph tyrosine kinase 2; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2; neuronally-expressed EPH-related tyrosine kinase; ELK; NET; EPHT2; FLJ37986; |
| Gene ID | 2047 |
| mRNA Refseq | NM_004441 |
| Protein Refseq | NP_004432 |
| MIM | 600600 |
| UniProt ID | P54762 |
| ◆ Recombinant Proteins | ||
| EPHB1-2870H | Recombinant Human EPHB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| EPHB1-3397H | Active Recombinant Human EPHB1 Protein, GST-tagged | +Inquiry |
| Ephb1-910M | Recombinant Mouse EphB1 protein(Met1-Leu539), His-tagged | +Inquiry |
| EPHB1-0988H | Recombinant Human EPHB1 Protein (D602-A896), His tagged | +Inquiry |
| EPHB1-2122R | Recombinant Rat EPHB1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPHB1-1852MCL | Recombinant Mouse EPHB1 cell lysate | +Inquiry |
| EPHB1-579MCL | Recombinant Mouse EPHB1 cell lysate | +Inquiry |
| EPHB1-158HKCL | Human EPHB1 Knockdown Cell Lysate | +Inquiry |
| EPHB1-1981HCL | Recombinant Human EPHB1 cell lysate | +Inquiry |
| EPHB1-001HCL | Recombinant Human EPHB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EPHB1 Products
Required fields are marked with *
My Review for All EPHB1 Products
Required fields are marked with *
