Recombinant Human EPHB1 Protein, GST-tagged
Cat.No. : | EPHB1-3399H |
Product Overview : | Human EPHB1 partial ORF ( NP_004432.1, 221 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.63 kDa |
AA Sequence : | ARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EPHB1 EPH receptor B1 [ Homo sapiens ] |
Official Symbol | EPHB1 |
Synonyms | EPHB1; EPH receptor B1; EphB1 , EPHT2; ephrin type-B receptor 1; Hek6; EK6; EPH-like kinase 6; eph tyrosine kinase 2; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2; neuronally-expressed EPH-related tyrosine kinase; ELK; NET; EPHT2; FLJ37986; |
Gene ID | 2047 |
mRNA Refseq | NM_004441 |
Protein Refseq | NP_004432 |
MIM | 600600 |
UniProt ID | P54762 |
◆ Recombinant Proteins | ||
EPHB1-01H | Active Recombinant Human EPHB1 Protein, His-tagged | +Inquiry |
EPHB1-3398H | Active Recombinant Human EPHB1 Protein, GST/His-tagged | +Inquiry |
Ephb1-468R | Active Recombinant Rat Eph Receptor B1, Fc-tagged | +Inquiry |
EPHB1-967H | Active Recombinant Human EPHB1 protein, His-tagged | +Inquiry |
EPHB1-59C | Recombinant Cynomolgus EPHB1, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPHB1-821CCL | Recombinant Cynomolgus EPHB1 cell lysate | +Inquiry |
EPHB1-1981HCL | Recombinant Human EPHB1 cell lysate | +Inquiry |
EPHB1-001HCL | Recombinant Human EPHB1 cell lysate | +Inquiry |
EPHB1-579MCL | Recombinant Mouse EPHB1 cell lysate | +Inquiry |
EPHB1-1852MCL | Recombinant Mouse EPHB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPHB1 Products
Required fields are marked with *
My Review for All EPHB1 Products
Required fields are marked with *
0
Inquiry Basket