Recombinant Human EPHB1 Protein, GST-tagged

Cat.No. : EPHB1-3399H
Product Overview : Human EPHB1 partial ORF ( NP_004432.1, 221 a.a. - 320 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.63 kDa
AA Sequence : ARGTCIPNAEEVDVPIKLYCNGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPICTCRTGYYRADFDPPEVACT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name EPHB1 EPH receptor B1 [ Homo sapiens ]
Official Symbol EPHB1
Synonyms EPHB1; EPH receptor B1; EphB1 , EPHT2; ephrin type-B receptor 1; Hek6; EK6; EPH-like kinase 6; eph tyrosine kinase 2; soluble EPHB1 variant 1; tyrosine-protein kinase receptor EPH-2; neuronally-expressed EPH-related tyrosine kinase; ELK; NET; EPHT2; FLJ37986;
Gene ID 2047
mRNA Refseq NM_004441
Protein Refseq NP_004432
MIM 600600
UniProt ID P54762

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EPHB1 Products

Required fields are marked with *

My Review for All EPHB1 Products

Required fields are marked with *

0
cart-icon